BLASTX nr result
ID: Chrysanthemum21_contig00047575
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00047575 (535 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017239628.1| PREDICTED: DNA topoisomerase 3-alpha-like [D... 56 8e-07 >ref|XP_017239628.1| PREDICTED: DNA topoisomerase 3-alpha-like [Daucus carota subsp. sativus] gb|KZN01629.1| hypothetical protein DCAR_010383 [Daucus carota subsp. sativus] Length = 126 Score = 55.8 bits (133), Expect = 8e-07 Identities = 28/60 (46%), Positives = 38/60 (63%), Gaps = 7/60 (11%) Frame = +1 Query: 355 LQMDSYLYSC-CGNDIVVLKVSNSEDNKGRMYYQCPLAKPK------NFGCGYFVWEDEL 513 ++M+SY C CG ++ K SNSE N+GRMYY CP AK ++GC +F+WED L Sbjct: 1 MEMESYEIDCKCGAGKMIRKRSNSEKNRGRMYYICPKAKKTETIGKWDWGCKHFLWEDVL 60