BLASTX nr result
ID: Chrysanthemum21_contig00047266
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00047266 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023736056.1| zinc finger CCCH domain-containing protein 5... 67 3e-10 >ref|XP_023736056.1| zinc finger CCCH domain-containing protein 5-like [Lactuca sativa] gb|PLY72090.1| hypothetical protein LSAT_9X121820 [Lactuca sativa] Length = 666 Score = 67.4 bits (163), Expect = 3e-10 Identities = 38/71 (53%), Positives = 43/71 (60%) Frame = +1 Query: 79 MTETVTTSQTDDKKPGTPENMEDREPSAAEQLKAVSXXXXXXXXXXXXXXXXXXELAEKA 258 MTE VTT QTDD++ GTP+NME+R PS KAVS ELAEKA Sbjct: 1 MTEPVTTGQTDDQEVGTPDNMEERNPSP----KAVSRKEKRKALKKDKRKQIRKELAEKA 56 Query: 259 RADEEARLNDP 291 R +EEARLNDP Sbjct: 57 RTEEEARLNDP 67