BLASTX nr result
ID: Chrysanthemum21_contig00046943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00046943 (564 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021982766.1| classical arabinogalactan protein 4-like [He... 55 3e-06 >ref|XP_021982766.1| classical arabinogalactan protein 4-like [Helianthus annuus] Length = 131 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +3 Query: 354 DVPNGSFADGWVNRVFIVGTAFAGSFIAISLI 449 DVPNGSFADGW+NR I GTAFAGS IA++++ Sbjct: 100 DVPNGSFADGWLNRAVIAGTAFAGSVIAVTMM 131