BLASTX nr result
ID: Chrysanthemum21_contig00046888
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00046888 (562 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY87957.1| hypothetical protein LSAT_3X107041 [Lactuca sativa] 58 8e-07 >gb|PLY87957.1| hypothetical protein LSAT_3X107041 [Lactuca sativa] Length = 217 Score = 57.8 bits (138), Expect = 8e-07 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 125 IMLCRTKEFAYECATYENLNARILDVFSEYLKKAKDHLSKVL 250 I+LCRTKE AY TYE L +ILDV EY KKA+DHLSK + Sbjct: 2 IVLCRTKEIAYTTCTYEYLRGKILDVLPEYSKKAEDHLSKAV 43