BLASTX nr result
ID: Chrysanthemum21_contig00045707
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00045707 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM28472.1| integral component of membrane [Ascochyta rabiei] 94 5e-20 gb|OSS50990.1| hypothetical protein B5807_04605 [Epicoccum nigrum] 85 2e-16 gb|OAK96379.1| hypothetical protein IQ06DRAFT_351809 [Stagonospo... 57 1e-06 >gb|KZM28472.1| integral component of membrane [Ascochyta rabiei] Length = 372 Score = 94.4 bits (233), Expect = 5e-20 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = -1 Query: 429 DTINQYRGRSPSAEVKKEDFPAAPKTDIKTEPIAEIPTTHENEPPLVPQTAL 274 +TINQYRGRSPSAEVKKEDFPAAPK D+KTE +EIPT HE EPPLVPQTAL Sbjct: 321 ETINQYRGRSPSAEVKKEDFPAAPKNDLKTEASSEIPTKHEQEPPLVPQTAL 372 >gb|OSS50990.1| hypothetical protein B5807_04605 [Epicoccum nigrum] Length = 373 Score = 84.7 bits (208), Expect = 2e-16 Identities = 45/59 (76%), Positives = 48/59 (81%), Gaps = 7/59 (11%) Frame = -1 Query: 429 DTINQYRGRSPSAEVKK------EDFPAAPKTDI-KTEPIAEIPTTHENEPPLVPQTAL 274 +TINQYRGRSPSAEVKK EDFPAAPKTD+ KTE AE+P HENEPPLVPQTAL Sbjct: 315 ETINQYRGRSPSAEVKKPAVVQKEDFPAAPKTDLPKTELDAEVPLKHENEPPLVPQTAL 373 >gb|OAK96379.1| hypothetical protein IQ06DRAFT_351809 [Stagonospora sp. SRC1lsM3a] Length = 369 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -1 Query: 429 DTINQYRGRSPSAEVKKEDFPAAPKTDIKTEPIAEIPTTHENEPPL 292 +TINQYRGRS S EVKKEDFPAAP+ D+ TE AE P T +P + Sbjct: 326 ETINQYRGRSTSPEVKKEDFPAAPRHDLPTE--AEKPVTAAPQPAI 369