BLASTX nr result
ID: Chrysanthemum21_contig00045699
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00045699 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY84122.1| hypothetical protein LSAT_6X116641 [Lactuca sativa] 64 9e-11 >gb|PLY84122.1| hypothetical protein LSAT_6X116641 [Lactuca sativa] Length = 81 Score = 63.9 bits (154), Expect = 9e-11 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 1/73 (1%) Frame = +3 Query: 48 MAIKINWMVPFLALMLIMGIVHEARPVYYS-GLKPTKRIATEYKPTMEKHPVHTNNLNDD 224 M IKINW V FL LMLI G + + T +A E K TM+KHP+H + +DD Sbjct: 1 MEIKINWFVLFLGLMLITGTIESGSDLPRKMSSHTTNDVAIENKYTMDKHPIHADGFDDD 60 Query: 225 DDAGIDSHHRYEY 263 GIDSHH Y + Sbjct: 61 FGKGIDSHHFYGF 73