BLASTX nr result
ID: Chrysanthemum21_contig00045509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00045509 (592 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH92076.1| Membrane transporter, Tim44-related/Ribosomal pro... 101 1e-21 >gb|KVH92076.1| Membrane transporter, Tim44-related/Ribosomal protein L45 [Cynara cardunculus var. scolymus] Length = 522 Score = 101 bits (252), Expect = 1e-21 Identities = 58/101 (57%), Positives = 65/101 (64%), Gaps = 1/101 (0%) Frame = -2 Query: 318 EDKLNPYGNLTQPNVHGMETWFGSSSCGPIERTKGETVRGELAKPKP-RKTVSINHTVEF 142 EDK +P G P +H P TKGE R AKPK RKTVSINH VE+ Sbjct: 425 EDKPDPNG----PPLH------------PFGSTKGENGRDVAAKPKAARKTVSINHNVEY 468 Query: 141 IDDYLSKKKRKRKAMEQWPSMDIEDDEIKPLRSILKAGKNQ 19 I+DY S KKRKRKAMEQWPSM+IE DE+KPL+SILK G Q Sbjct: 469 IEDYTSNKKRKRKAMEQWPSMEIEGDELKPLKSILKVGSKQ 509