BLASTX nr result
ID: Chrysanthemum21_contig00045503
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00045503 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI03931.1| hypothetical protein Ccrd_017748 [Cynara carduncu... 54 6e-06 >gb|KVI03931.1| hypothetical protein Ccrd_017748 [Cynara cardunculus var. scolymus] Length = 379 Score = 54.3 bits (129), Expect = 6e-06 Identities = 24/49 (48%), Positives = 31/49 (63%) Frame = -1 Query: 228 IPNYEQCENFIRSSPLNMGSPPTAAPWKPKCSLFDNNQIIMIHYVLIDI 82 +PNYE E+ IRSSPLNM + PWKP L DNNQ +MI + ++ Sbjct: 35 LPNYELREDIIRSSPLNMSPQQSEEPWKPISGLIDNNQFVMIEPTVTNV 83