BLASTX nr result
ID: Chrysanthemum21_contig00045334
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00045334 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88206.1| Leucine-rich repeat-containing protein [Cynara ca... 104 2e-23 gb|PLY89708.1| hypothetical protein LSAT_7X29400 [Lactuca sativa] 100 9e-22 ref|XP_023758154.1| 187-kDa microtubule-associated protein AIR9 ... 100 9e-22 ref|XP_023758150.1| 187-kDa microtubule-associated protein AIR9 ... 100 9e-22 ref|XP_022035558.1| 187-kDa microtubule-associated protein AIR9 ... 99 3e-21 ref|XP_022035556.1| 187-kDa microtubule-associated protein AIR9 ... 99 3e-21 ref|XP_008372215.1| PREDICTED: 187-kDa microtubule-associated pr... 94 2e-19 ref|XP_021812390.1| 187-kDa microtubule-associated protein AIR9 ... 93 3e-19 ref|XP_008225584.1| PREDICTED: 187-kDa microtubule-associated pr... 93 3e-19 ref|XP_007213737.1| 187-kDa microtubule-associated protein AIR9 ... 93 3e-19 gb|ONI11138.1| hypothetical protein PRUPE_4G089200 [Prunus persica] 93 3e-19 gb|ONI11139.1| hypothetical protein PRUPE_4G089200 [Prunus persica] 93 3e-19 dbj|GAV67239.1| LRR_4 domain-containing protein [Cephalotus foll... 91 2e-18 ref|XP_019078155.1| PREDICTED: 187-kDa microtubule-associated pr... 89 6e-18 ref|XP_002274947.2| PREDICTED: 187-kDa microtubule-associated pr... 89 6e-18 ref|XP_010655726.1| PREDICTED: 187-kDa microtubule-associated pr... 89 6e-18 ref|XP_019078154.1| PREDICTED: 187-kDa microtubule-associated pr... 89 6e-18 ref|XP_019078153.1| PREDICTED: 187-kDa microtubule-associated pr... 89 6e-18 ref|XP_019078150.1| PREDICTED: 187-kDa microtubule-associated pr... 89 6e-18 gb|EOX96968.1| Outer arm dynein light chain 1 protein isoform 2 ... 88 1e-17 >gb|KVH88206.1| Leucine-rich repeat-containing protein [Cynara cardunculus var. scolymus] Length = 1661 Score = 104 bits (260), Expect = 2e-23 Identities = 52/61 (85%), Positives = 58/61 (95%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 E+MST+SSQRKA T E+RVSRLIMLP+VEIKA DDVRLDLRGHRIR+LKA+GLNLSPNLE Sbjct: 240 EKMSTSSSQRKATTPEIRVSRLIMLPQVEIKAGDDVRLDLRGHRIRTLKASGLNLSPNLE 299 Query: 5 F 3 F Sbjct: 300 F 300 >gb|PLY89708.1| hypothetical protein LSAT_7X29400 [Lactuca sativa] Length = 1670 Score = 100 bits (248), Expect = 9e-22 Identities = 51/61 (83%), Positives = 58/61 (95%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 ERMST+SSQRKAAT E+R+SRLIMLP+VE KA+DDVRLDLRGHRIRSLKA G+N+SPNLE Sbjct: 221 ERMSTSSSQRKAATPEIRISRLIMLPQVETKANDDVRLDLRGHRIRSLKA-GMNMSPNLE 279 Query: 5 F 3 F Sbjct: 280 F 280 >ref|XP_023758154.1| 187-kDa microtubule-associated protein AIR9 isoform X2 [Lactuca sativa] Length = 1691 Score = 100 bits (248), Expect = 9e-22 Identities = 51/61 (83%), Positives = 58/61 (95%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 ERMST+SSQRKAAT E+R+SRLIMLP+VE KA+DDVRLDLRGHRIRSLKA G+N+SPNLE Sbjct: 221 ERMSTSSSQRKAATPEIRISRLIMLPQVETKANDDVRLDLRGHRIRSLKA-GMNMSPNLE 279 Query: 5 F 3 F Sbjct: 280 F 280 >ref|XP_023758150.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Lactuca sativa] ref|XP_023758151.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Lactuca sativa] ref|XP_023758152.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Lactuca sativa] ref|XP_023758153.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Lactuca sativa] Length = 1692 Score = 100 bits (248), Expect = 9e-22 Identities = 51/61 (83%), Positives = 58/61 (95%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 ERMST+SSQRKAAT E+R+SRLIMLP+VE KA+DDVRLDLRGHRIRSLKA G+N+SPNLE Sbjct: 221 ERMSTSSSQRKAATPEIRISRLIMLPQVETKANDDVRLDLRGHRIRSLKA-GMNMSPNLE 279 Query: 5 F 3 F Sbjct: 280 F 280 >ref|XP_022035558.1| 187-kDa microtubule-associated protein AIR9 isoform X2 [Helianthus annuus] gb|OTG29148.1| putative outer arm dynein light chain 1 protein [Helianthus annuus] Length = 1672 Score = 98.6 bits (244), Expect = 3e-21 Identities = 51/61 (83%), Positives = 54/61 (88%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 ERMSTASS RKA T +VSRLIMLP+VE KA DDVRLDLRGHRIRSLKA+GLNLSPNLE Sbjct: 201 ERMSTASSLRKAVTPAFKVSRLIMLPQVETKAGDDVRLDLRGHRIRSLKASGLNLSPNLE 260 Query: 5 F 3 F Sbjct: 261 F 261 >ref|XP_022035556.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Helianthus annuus] ref|XP_022035557.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Helianthus annuus] Length = 1673 Score = 98.6 bits (244), Expect = 3e-21 Identities = 51/61 (83%), Positives = 54/61 (88%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 ERMSTASS RKA T +VSRLIMLP+VE KA DDVRLDLRGHRIRSLKA+GLNLSPNLE Sbjct: 201 ERMSTASSLRKAVTPAFKVSRLIMLPQVETKAGDDVRLDLRGHRIRSLKASGLNLSPNLE 260 Query: 5 F 3 F Sbjct: 261 F 261 >ref|XP_008372215.1| PREDICTED: 187-kDa microtubule-associated protein AIR9-like [Malus domestica] ref|XP_008372216.1| PREDICTED: 187-kDa microtubule-associated protein AIR9-like [Malus domestica] Length = 1713 Score = 93.6 bits (231), Expect = 2e-19 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RK AT+E R SR I+LP+VEIKASDD+RLDLRGHR+RSLKANGLNLSPNLE Sbjct: 241 DRSSSLSGRRKTATHESRDSRFIVLPQVEIKASDDLRLDLRGHRVRSLKANGLNLSPNLE 300 Query: 5 F 3 F Sbjct: 301 F 301 >ref|XP_021812390.1| 187-kDa microtubule-associated protein AIR9 [Prunus avium] ref|XP_021812391.1| 187-kDa microtubule-associated protein AIR9 [Prunus avium] Length = 1718 Score = 93.2 bits (230), Expect = 3e-19 Identities = 47/61 (77%), Positives = 54/61 (88%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RKAAT E R SRLI+LPKVEIKA DD+RLDLRGHR+RSLKA+GLNLSPNLE Sbjct: 246 DRSSSLSGRRKAATPEGRDSRLIVLPKVEIKAGDDLRLDLRGHRVRSLKASGLNLSPNLE 305 Query: 5 F 3 F Sbjct: 306 F 306 >ref|XP_008225584.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 [Prunus mume] ref|XP_008225585.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 [Prunus mume] Length = 1718 Score = 93.2 bits (230), Expect = 3e-19 Identities = 47/61 (77%), Positives = 54/61 (88%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RKAAT E R SRLI+LPKVEIKA DD+RLDLRGHR+RSLKA+GLNLSPNLE Sbjct: 246 DRSSSLSGRRKAATPEGRDSRLIVLPKVEIKAGDDLRLDLRGHRVRSLKASGLNLSPNLE 305 Query: 5 F 3 F Sbjct: 306 F 306 >ref|XP_007213737.1| 187-kDa microtubule-associated protein AIR9 isoform X2 [Prunus persica] ref|XP_020417374.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Prunus persica] gb|ONI11137.1| hypothetical protein PRUPE_4G089200 [Prunus persica] Length = 1718 Score = 93.2 bits (230), Expect = 3e-19 Identities = 47/61 (77%), Positives = 54/61 (88%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RKAAT E R SRLI+LPKVEIKA DD+RLDLRGHR+RSLKA+GLNLSPNLE Sbjct: 246 DRSSSLSGRRKAATPEGRDSRLIVLPKVEIKAGDDLRLDLRGHRVRSLKASGLNLSPNLE 305 Query: 5 F 3 F Sbjct: 306 F 306 >gb|ONI11138.1| hypothetical protein PRUPE_4G089200 [Prunus persica] Length = 1726 Score = 93.2 bits (230), Expect = 3e-19 Identities = 47/61 (77%), Positives = 54/61 (88%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RKAAT E R SRLI+LPKVEIKA DD+RLDLRGHR+RSLKA+GLNLSPNLE Sbjct: 246 DRSSSLSGRRKAATPEGRDSRLIVLPKVEIKAGDDLRLDLRGHRVRSLKASGLNLSPNLE 305 Query: 5 F 3 F Sbjct: 306 F 306 >gb|ONI11139.1| hypothetical protein PRUPE_4G089200 [Prunus persica] Length = 1778 Score = 93.2 bits (230), Expect = 3e-19 Identities = 47/61 (77%), Positives = 54/61 (88%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RKAAT E R SRLI+LPKVEIKA DD+RLDLRGHR+RSLKA+GLNLSPNLE Sbjct: 246 DRSSSLSGRRKAATPEGRDSRLIVLPKVEIKAGDDLRLDLRGHRVRSLKASGLNLSPNLE 305 Query: 5 F 3 F Sbjct: 306 F 306 >dbj|GAV67239.1| LRR_4 domain-containing protein [Cephalotus follicularis] Length = 1719 Score = 90.5 bits (223), Expect = 2e-18 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R ST S +RK+AT E R SR IMLP VE+KA DDVRLDLRGHRIRSL A+GLNLSPNLE Sbjct: 247 QRSSTLSGRRKSATPESRDSRFIMLPLVEVKAGDDVRLDLRGHRIRSLNASGLNLSPNLE 306 Query: 5 F 3 F Sbjct: 307 F 307 >ref|XP_019078155.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X6 [Vitis vinifera] Length = 1639 Score = 89.4 bits (220), Expect = 6e-18 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 5 F 3 F Sbjct: 305 F 305 >ref|XP_002274947.2| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X5 [Vitis vinifera] emb|CBI30992.3| unnamed protein product, partial [Vitis vinifera] Length = 1717 Score = 89.4 bits (220), Expect = 6e-18 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 5 F 3 F Sbjct: 305 F 305 >ref|XP_010655726.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X4 [Vitis vinifera] Length = 1725 Score = 89.4 bits (220), Expect = 6e-18 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 5 F 3 F Sbjct: 305 F 305 >ref|XP_019078154.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X3 [Vitis vinifera] Length = 1734 Score = 89.4 bits (220), Expect = 6e-18 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 5 F 3 F Sbjct: 305 F 305 >ref|XP_019078153.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X2 [Vitis vinifera] Length = 1740 Score = 89.4 bits (220), Expect = 6e-18 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 5 F 3 F Sbjct: 305 F 305 >ref|XP_019078150.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X1 [Vitis vinifera] ref|XP_019078151.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X1 [Vitis vinifera] ref|XP_019078152.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X1 [Vitis vinifera] Length = 1741 Score = 89.4 bits (220), Expect = 6e-18 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 5 F 3 F Sbjct: 305 F 305 >gb|EOX96968.1| Outer arm dynein light chain 1 protein isoform 2 [Theobroma cacao] Length = 1618 Score = 88.2 bits (217), Expect = 1e-17 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = -1 Query: 185 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 6 +R S S ++KAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 248 DRSSNLSGRKKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 307 Query: 5 F 3 F Sbjct: 308 F 308