BLASTX nr result
ID: Chrysanthemum21_contig00045219
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00045219 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023758837.1| E3 ubiquitin-protein ligase RDUF2-like [Lact... 70 3e-11 gb|KVI03626.1| protein of unknown function DUF1117 [Cynara cardu... 70 4e-11 gb|KVI11957.1| protein of unknown function DUF1117 [Cynara cardu... 70 4e-11 ref|XP_023732513.1| E3 ubiquitin-protein ligase RDUF1-like [Lact... 65 1e-09 ref|XP_022037315.1| E3 ubiquitin-protein ligase RDUF2-like [Heli... 55 5e-06 >ref|XP_023758837.1| E3 ubiquitin-protein ligase RDUF2-like [Lactuca sativa] gb|PLY89240.1| hypothetical protein LSAT_5X169160 [Lactuca sativa] Length = 385 Score = 70.5 bits (171), Expect = 3e-11 Identities = 41/99 (41%), Positives = 45/99 (45%) Frame = +1 Query: 1 PVVYTEMDGGFSNELGTPRRVMWEVRRGNCVGEXXXXXXXXXXXXXXXXLXXXXXXXXXX 180 PVVYTEMDGGF+N GTPRR+MWE RR + GE L Sbjct: 288 PVVYTEMDGGFNNNSGTPRRIMWESRRNSAGGESGIGRAFRNMFSFFGRL-RPSSNSTTN 346 Query: 181 XXXXXXXXXXXXXXXXXXXXXXRRSRTWILDEQSGMSRW 297 RRSRTWILDEQ+GMSRW Sbjct: 347 SGGASMARSRSLSSSVFGRMTRRRSRTWILDEQNGMSRW 385 >gb|KVI03626.1| protein of unknown function DUF1117 [Cynara cardunculus var. scolymus] Length = 383 Score = 70.1 bits (170), Expect = 4e-11 Identities = 41/99 (41%), Positives = 45/99 (45%) Frame = +1 Query: 1 PVVYTEMDGGFSNELGTPRRVMWEVRRGNCVGEXXXXXXXXXXXXXXXXLXXXXXXXXXX 180 PVVYTEMDGGF+N GTPRR+MWE RR + GE L Sbjct: 286 PVVYTEMDGGFNNNSGTPRRIMWESRRNSTRGESGIGRVFRNMFSFFGRL-RPSSNSTSN 344 Query: 181 XXXXXXXXXXXXXXXXXXXXXXRRSRTWILDEQSGMSRW 297 RRSRTWILDEQ+GMSRW Sbjct: 345 SSGASIARSRSLSSSVFGRMTRRRSRTWILDEQNGMSRW 383 >gb|KVI11957.1| protein of unknown function DUF1117 [Cynara cardunculus var. scolymus] Length = 354 Score = 69.7 bits (169), Expect = 4e-11 Identities = 39/99 (39%), Positives = 45/99 (45%) Frame = +1 Query: 1 PVVYTEMDGGFSNELGTPRRVMWEVRRGNCVGEXXXXXXXXXXXXXXXXLXXXXXXXXXX 180 PVVYTEMDGGF+N GTPRR+MWE RRG GE L Sbjct: 261 PVVYTEMDGGFNNSTGTPRRIMWESRRGRTRGEGGFGRAFRNMFSFFGRL-----RSSSN 315 Query: 181 XXXXXXXXXXXXXXXXXXXXXXRRSRTWILDEQSGMSRW 297 RR+RTW+LDEQ+G+SRW Sbjct: 316 SNGSSMNRSRSVSSSVFSRMTSRRNRTWVLDEQNGLSRW 354 >ref|XP_023732513.1| E3 ubiquitin-protein ligase RDUF1-like [Lactuca sativa] gb|PLY74838.1| hypothetical protein LSAT_8X72880 [Lactuca sativa] Length = 375 Score = 65.5 bits (158), Expect = 1e-09 Identities = 38/99 (38%), Positives = 43/99 (43%) Frame = +1 Query: 1 PVVYTEMDGGFSNELGTPRRVMWEVRRGNCVGEXXXXXXXXXXXXXXXXLXXXXXXXXXX 180 PVVYTEMDGGF+N GTPRR+MWE RR GE Sbjct: 282 PVVYTEMDGGFNNSSGTPRRIMWESRRNRTRGEGGFGRVFRNIFS-----FFGRSRPSSN 336 Query: 181 XXXXXXXXXXXXXXXXXXXXXXRRSRTWILDEQSGMSRW 297 RR+RTWILDEQ+G+SRW Sbjct: 337 SNGSSMNRSRSLSSSVFGRMRSRRNRTWILDEQNGLSRW 375 >ref|XP_022037315.1| E3 ubiquitin-protein ligase RDUF2-like [Helianthus annuus] gb|OTG24302.1| putative zinc finger (C3HC4-type RING finger) family protein [Helianthus annuus] Length = 373 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +1 Query: 1 PVVYTEMDGGFSNELGTPRRVMWEVRRGNCVGE 99 PVVYTEMDGGFSN LGTPRRVMWE R GE Sbjct: 280 PVVYTEMDGGFSNGLGTPRRVMWESGRNRGNGE 312