BLASTX nr result
ID: Chrysanthemum21_contig00045203
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00045203 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022010587.1| pentatricopeptide repeat-containing protein ... 114 4e-27 ref|XP_002305756.1| hypothetical protein POPTR_0004s05320g [Popu... 106 4e-24 gb|PNT39701.1| hypothetical protein POPTR_004G054000v3 [Populus ... 106 5e-24 ref|XP_015576869.1| PREDICTED: pentatricopeptide repeat-containi... 105 8e-24 ref|XP_011027713.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-23 ref|XP_021598104.1| pentatricopeptide repeat-containing protein ... 102 1e-22 ref|XP_016900228.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-22 ref|XP_022715777.1| pentatricopeptide repeat-containing protein ... 100 7e-22 ref|XP_021294432.1| pentatricopeptide repeat-containing protein ... 100 9e-22 ref|XP_023736919.1| pentatricopeptide repeat-containing protein ... 100 1e-21 gb|KVH97013.1| Pentatricopeptide repeat-containing protein [Cyna... 100 1e-21 ref|XP_004149063.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-21 ref|XP_014518000.1| pentatricopeptide repeat-containing protein ... 99 1e-21 ref|XP_003541711.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-21 gb|PHU00028.1| Pentatricopeptide repeat-containing protein, mito... 99 2e-21 ref|XP_020205067.1| pentatricopeptide repeat-containing protein ... 99 2e-21 ref|XP_016551851.1| PREDICTED: pentatricopeptide repeat-containi... 99 2e-21 gb|PHT31288.1| hypothetical protein CQW23_27625 [Capsicum baccatum] 99 2e-21 gb|POF20090.1| pentatricopeptide repeat-containing protein, mito... 97 2e-21 dbj|GAV71068.1| PPR domain-containing protein/PPR_2 domain-conta... 98 3e-21 >ref|XP_022010587.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Helianthus annuus] gb|OTF93883.1| putative tetratricopeptide repeat (TPR)-like superfamily protein [Helianthus annuus] Length = 537 Score = 114 bits (286), Expect = 4e-27 Identities = 64/101 (63%), Positives = 70/101 (69%), Gaps = 8/101 (7%) Frame = -1 Query: 281 MNKSSLLKP--------LIPXXXXXXXXXXXTQIASTSLSQTLRFYINSNTPLHGQHIHT 126 M K SLLKP LIP Q+ STSLS +L+ YINSNTP HGQ IHT Sbjct: 1 MGKLSLLKPSISTTKTSLIPTENSSHGQLF--QLTSTSLSLSLQNYINSNTPSHGQKIHT 58 Query: 125 HILKTGYIPNTNISIKLLILHLKCSCLVYARQVFDEMPQRT 3 HI+KTG+ PNTNI IKL+ILHLK SCL YARQVFDEMPQRT Sbjct: 59 HIIKTGFKPNTNILIKLMILHLKSSCLFYARQVFDEMPQRT 99 >ref|XP_002305756.1| hypothetical protein POPTR_0004s05320g [Populus trichocarpa] Length = 530 Score = 106 bits (264), Expect = 4e-24 Identities = 49/65 (75%), Positives = 55/65 (84%) Frame = -1 Query: 197 TSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFDE 18 T+LS L+ YINS+TP HGQ IHTHILKTG+ PN NISIKLLILHLKC CL YA Q+FDE Sbjct: 43 TTLSSALQHYINSDTPFHGQKIHTHILKTGFRPNINISIKLLILHLKCRCLKYAHQLFDE 102 Query: 17 MPQRT 3 +PQRT Sbjct: 103 LPQRT 107 >gb|PNT39701.1| hypothetical protein POPTR_004G054000v3 [Populus trichocarpa] Length = 568 Score = 106 bits (264), Expect = 5e-24 Identities = 49/65 (75%), Positives = 55/65 (84%) Frame = -1 Query: 197 TSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFDE 18 T+LS L+ YINS+TP HGQ IHTHILKTG+ PN NISIKLLILHLKC CL YA Q+FDE Sbjct: 81 TTLSSALQHYINSDTPFHGQKIHTHILKTGFRPNINISIKLLILHLKCRCLKYAHQLFDE 140 Query: 17 MPQRT 3 +PQRT Sbjct: 141 LPQRT 145 >ref|XP_015576869.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Ricinus communis] gb|EEF39843.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 530 Score = 105 bits (262), Expect = 8e-24 Identities = 47/66 (71%), Positives = 57/66 (86%) Frame = -1 Query: 200 STSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFD 21 + +LS L+ +INSNTP HGQ IH HI+KTG+IPNTN+SIKLLIL+LKC CL YARQ+FD Sbjct: 42 AAALSSALQDHINSNTPFHGQKIHAHIVKTGFIPNTNVSIKLLILYLKCGCLKYARQMFD 101 Query: 20 EMPQRT 3 E+PQRT Sbjct: 102 ELPQRT 107 >ref|XP_011027713.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Populus euphratica] Length = 582 Score = 104 bits (259), Expect = 2e-23 Identities = 48/65 (73%), Positives = 54/65 (83%) Frame = -1 Query: 197 TSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFDE 18 T+LS L+ YINS+TP HGQ IHTHILKTG+ PN NISIKLLILHLKC CL YA Q+ DE Sbjct: 95 TTLSSALQHYINSDTPFHGQKIHTHILKTGFRPNINISIKLLILHLKCGCLKYAHQLLDE 154 Query: 17 MPQRT 3 +PQRT Sbjct: 155 LPQRT 159 >ref|XP_021598104.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] ref|XP_021598105.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] ref|XP_021598106.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] ref|XP_021598107.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] ref|XP_021598108.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] ref|XP_021598109.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] gb|OAY26293.1| hypothetical protein MANES_16G036200 [Manihot esculenta] Length = 546 Score = 102 bits (254), Expect = 1e-22 Identities = 47/66 (71%), Positives = 57/66 (86%) Frame = -1 Query: 200 STSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFD 21 +T+LS L+ YINS+ P +GQ IH HILK+G+IPNTNISIKLLIL+LKC CL YARQVFD Sbjct: 43 ATTLSSVLQRYINSDNPFYGQKIHAHILKSGFIPNTNISIKLLILNLKCGCLKYARQVFD 102 Query: 20 EMPQRT 3 E+P+RT Sbjct: 103 ELPRRT 108 >ref|XP_016900228.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Cucumis melo] Length = 523 Score = 100 bits (250), Expect = 4e-22 Identities = 48/66 (72%), Positives = 54/66 (81%) Frame = -1 Query: 200 STSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFD 21 STSLS L+ YINS+ P HG IH HILKTG+IPNTNISIKLLILHLKC L +ARQVFD Sbjct: 34 STSLSSALQHYINSDDPSHGLKIHAHILKTGFIPNTNISIKLLILHLKCKSLKFARQVFD 93 Query: 20 EMPQRT 3 +PQ+T Sbjct: 94 ALPQKT 99 >ref|XP_022715777.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Durio zibethinus] ref|XP_022715778.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Durio zibethinus] Length = 535 Score = 100 bits (248), Expect = 7e-22 Identities = 46/65 (70%), Positives = 55/65 (84%) Frame = -1 Query: 197 TSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFDE 18 T+LS ++ +INS+TP HGQ IHTHI+K+G+ PNTNISIKLLILHLK CL YA QVFDE Sbjct: 47 TTLSIAIQHFINSDTPFHGQKIHTHIIKSGFSPNTNISIKLLILHLKTGCLNYASQVFDE 106 Query: 17 MPQRT 3 +PQRT Sbjct: 107 LPQRT 111 >ref|XP_021294432.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Herrania umbratica] Length = 532 Score = 99.8 bits (247), Expect = 9e-22 Identities = 44/66 (66%), Positives = 56/66 (84%) Frame = -1 Query: 200 STSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFD 21 +T+LS L+ +INS+TP HGQ IHTHI+K+G+ PNTN+SIKLLILHLK CL YA Q+FD Sbjct: 43 ATTLSSALQHFINSDTPFHGQKIHTHIIKSGFSPNTNVSIKLLILHLKSGCLKYASQMFD 102 Query: 20 EMPQRT 3 E+PQ+T Sbjct: 103 ELPQQT 108 >ref|XP_023736919.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Lactuca sativa] gb|PLY97100.1| hypothetical protein LSAT_4X49741 [Lactuca sativa] Length = 535 Score = 99.8 bits (247), Expect = 1e-21 Identities = 48/66 (72%), Positives = 56/66 (84%) Frame = -1 Query: 200 STSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFD 21 + SLS L+ YINS+TP HGQ IHT+I+KTGY NTNISIKLLILHLKCSCL+YARQVFD Sbjct: 40 AASLSLLLQSYINSDTPWHGQKIHTNIIKTGYRSNTNISIKLLILHLKCSCLLYARQVFD 99 Query: 20 EMPQRT 3 ++ Q T Sbjct: 100 DLRQPT 105 >gb|KVH97013.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 535 Score = 99.8 bits (247), Expect = 1e-21 Identities = 48/66 (72%), Positives = 56/66 (84%) Frame = -1 Query: 200 STSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFD 21 +TSLS L+ YINS+TP HGQ IHTHI+KTG+ NTNISIKLLILHLK SCL+YARQVFD Sbjct: 37 ATSLSLLLQSYINSDTPFHGQKIHTHIIKTGFPSNTNISIKLLILHLKSSCLLYARQVFD 96 Query: 20 EMPQRT 3 ++ Q T Sbjct: 97 DLRQPT 102 >ref|XP_004149063.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Cucumis sativus] ref|XP_011657846.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Cucumis sativus] gb|KGN65649.1| hypothetical protein Csa_1G478080 [Cucumis sativus] Length = 523 Score = 99.4 bits (246), Expect = 1e-21 Identities = 47/66 (71%), Positives = 53/66 (80%) Frame = -1 Query: 200 STSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFD 21 STSLS L+ YINS+ P HG IH HILKTG+IPNTNISIKLLILHLKC L +ARQ FD Sbjct: 34 STSLSSALQHYINSDDPSHGLKIHAHILKTGFIPNTNISIKLLILHLKCKSLKFARQAFD 93 Query: 20 EMPQRT 3 +PQ+T Sbjct: 94 ALPQKT 99 >ref|XP_014518000.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Vigna radiata var. radiata] Length = 525 Score = 99.4 bits (246), Expect = 1e-21 Identities = 46/66 (69%), Positives = 56/66 (84%) Frame = -1 Query: 200 STSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFD 21 ST LS L+ YINS+TP HGQ IH+ ILK+G++PNTNISIKLLIL+LKC+CL YARQVFD Sbjct: 36 STLLSSALQHYINSDTPTHGQKIHSRILKSGFVPNTNISIKLLILYLKCNCLRYARQVFD 95 Query: 20 EMPQRT 3 ++ RT Sbjct: 96 DLRDRT 101 >ref|XP_003541711.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Glycine max] gb|KRH21311.1| hypothetical protein GLYMA_13G232000 [Glycine max] Length = 525 Score = 99.4 bits (246), Expect = 1e-21 Identities = 46/66 (69%), Positives = 55/66 (83%) Frame = -1 Query: 200 STSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFD 21 STS S L+ YINS TP HGQ IH+ ILK+G++PNTNISIKLLIL+LKC+CL YARQVFD Sbjct: 36 STSFSNALQLYINSETPSHGQKIHSSILKSGFVPNTNISIKLLILYLKCNCLRYARQVFD 95 Query: 20 EMPQRT 3 ++ RT Sbjct: 96 DLRDRT 101 >gb|PHU00028.1| Pentatricopeptide repeat-containing protein, mitochondrial [Capsicum chinense] Length = 525 Score = 99.0 bits (245), Expect = 2e-21 Identities = 47/65 (72%), Positives = 57/65 (87%) Frame = -1 Query: 197 TSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFDE 18 +S+S +L+ YINS+TP+HGQ IH++ILKTGY PNTNI IKLLIL+LK SCL YARQVFDE Sbjct: 31 SSMSLSLQNYINSDTPIHGQKIHSYILKTGYKPNTNIRIKLLILYLKSSCLFYARQVFDE 90 Query: 17 MPQRT 3 MP+ T Sbjct: 91 MPKPT 95 >ref|XP_020205067.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Cajanus cajan] Length = 525 Score = 99.0 bits (245), Expect = 2e-21 Identities = 47/66 (71%), Positives = 54/66 (81%) Frame = -1 Query: 200 STSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFD 21 ST LS L+ YINS TP HGQ IH+ ILKTG+ PNTNISIKLLIL+LKC+CL YARQVFD Sbjct: 36 STLLSNALQHYINSETPSHGQKIHSRILKTGFFPNTNISIKLLILYLKCNCLRYARQVFD 95 Query: 20 EMPQRT 3 ++ RT Sbjct: 96 DLRDRT 101 >ref|XP_016551851.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Capsicum annuum] gb|PHT64954.1| Pentatricopeptide repeat-containing protein, mitochondrial [Capsicum annuum] Length = 525 Score = 99.0 bits (245), Expect = 2e-21 Identities = 47/65 (72%), Positives = 57/65 (87%) Frame = -1 Query: 197 TSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFDE 18 +S+S +L+ YINS+TP+HGQ IH++ILKTGY PNTNI IKLLIL+LK SCL YARQVFDE Sbjct: 31 SSMSLSLQNYINSDTPIHGQKIHSYILKTGYKPNTNIRIKLLILYLKSSCLFYARQVFDE 90 Query: 17 MPQRT 3 MP+ T Sbjct: 91 MPKPT 95 >gb|PHT31288.1| hypothetical protein CQW23_27625 [Capsicum baccatum] Length = 547 Score = 99.0 bits (245), Expect = 2e-21 Identities = 47/65 (72%), Positives = 57/65 (87%) Frame = -1 Query: 197 TSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFDE 18 +S+S +L+ YINS+TP+HGQ IH++ILKTGY PNTNI IKLLIL+LK SCL YARQVFDE Sbjct: 53 SSMSLSLQNYINSDTPIHGQKIHSYILKTGYKPNTNIRIKLLILYLKSSCLFYARQVFDE 112 Query: 17 MPQRT 3 MP+ T Sbjct: 113 MPKPT 117 >gb|POF20090.1| pentatricopeptide repeat-containing protein, mitochondrial [Quercus suber] Length = 370 Score = 97.4 bits (241), Expect = 2e-21 Identities = 46/66 (69%), Positives = 55/66 (83%) Frame = -1 Query: 200 STSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQVFD 21 +TSLS L+ YINS+ P +GQ IH+HILKTG+ PNTNISIKLLILHLKC + YAR+VFD Sbjct: 42 ATSLSSALQQYINSDNPSYGQKIHSHILKTGFRPNTNISIKLLILHLKCGYIKYARKVFD 101 Query: 20 EMPQRT 3 E+PQ T Sbjct: 102 ELPQTT 107 >dbj|GAV71068.1| PPR domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein, partial [Cephalotus follicularis] Length = 431 Score = 97.8 bits (242), Expect = 3e-21 Identities = 45/69 (65%), Positives = 59/69 (85%) Frame = -1 Query: 209 QIASTSLSQTLRFYINSNTPLHGQHIHTHILKTGYIPNTNISIKLLILHLKCSCLVYARQ 30 Q+ +TSLS TL+ +I+SNTP HG+ IHT I+K+G+ PN+NISIKLLIL+LK CL Y+RQ Sbjct: 2 QLNATSLSSTLQHHIDSNTPKHGRKIHTQIIKSGFRPNSNISIKLLILYLKSGCLKYSRQ 61 Query: 29 VFDEMPQRT 3 +FDE+PQRT Sbjct: 62 MFDELPQRT 70