BLASTX nr result
ID: Chrysanthemum21_contig00044726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00044726 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY75143.1| hypothetical protein LSAT_4X41000 [Lactuca sativa] 72 1e-12 >gb|PLY75143.1| hypothetical protein LSAT_4X41000 [Lactuca sativa] Length = 179 Score = 72.0 bits (175), Expect = 1e-12 Identities = 47/111 (42%), Positives = 62/111 (55%) Frame = +2 Query: 131 LPPKAKNRKELRLKCMKIGKIPPLLSFLAKSAGFICFSRYYKKFGNLFPMSACEVNGSNI 310 +P K+R+ LR K MKIG +P LLSFLAK F S ++K LF A + S + Sbjct: 10 IPIGNKSRQGLRKKFMKIGGVPKLLSFLAKIVSFF-LSHNHQKLIVLFKKFAYDAKPSYV 68 Query: 311 LLMFWALSFLVVAIYLRGSSKRSSDNEACQYHSVSCLSDIYLHPSSYKVDK 463 LLMF+ +S L+V I+ R + E QYHS S S + LHP YK D+ Sbjct: 69 LLMFFTISILIVGIFSRIA------QEDFQYHSDSFFSALELHPLPYKFDE 113