BLASTX nr result
ID: Chrysanthemum21_contig00044491
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00044491 (454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AQQ72784.1| CYC4 [Chrysanthemum lavandulifolium] 110 1e-26 gb|AMR68929.1| flower asymmetry transporter CYC2a [Chrysanthemum... 99 6e-22 gb|APJ35648.1| flower asymmetry transporter ClCYC2a [Chrysanthem... 99 6e-22 gb|AEX07364.1| cycloidea-like 7 [Gerbera hybrid cultivar] 57 2e-06 ref|XP_023748106.1| transcription factor CYCLOIDEA-like [Lactuca... 55 6e-06 >gb|AQQ72784.1| CYC4 [Chrysanthemum lavandulifolium] Length = 295 Score = 110 bits (276), Expect = 1e-26 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 318 CHGFHPPSGFFSGQEKDGGYYNHHPFVAQDCSFNHAPLPPPPPIK 452 CHGFHPPSGFFSGQEKDGGYYNHHPFVAQDCSFNHAPLPPPPPIK Sbjct: 12 CHGFHPPSGFFSGQEKDGGYYNHHPFVAQDCSFNHAPLPPPPPIK 56 >gb|AMR68929.1| flower asymmetry transporter CYC2a [Chrysanthemum x morifolium] Length = 297 Score = 98.6 bits (244), Expect = 6e-22 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +3 Query: 318 CHGFHPPSGFFSGQEKDGGYYNHHPFVAQDCSFNHAPLPPPPPIK 452 CHGFHPPS FFSGQEKDGGY HHPFVAQDCSFNHAPLPPPPPIK Sbjct: 12 CHGFHPPSSFFSGQEKDGGY--HHPFVAQDCSFNHAPLPPPPPIK 54 >gb|APJ35648.1| flower asymmetry transporter ClCYC2a [Chrysanthemum lavandulifolium] Length = 298 Score = 98.6 bits (244), Expect = 6e-22 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = +3 Query: 318 CHGFHPPSGFFSGQEKDGGYYNHHPFVAQDCSFNHAPLPPPPPIK 452 CHGFHPPSGF S QEKDGGYYNHHPFVAQDCSFNHAP P PPPI+ Sbjct: 12 CHGFHPPSGFISCQEKDGGYYNHHPFVAQDCSFNHAPSPSPPPIR 56 >gb|AEX07364.1| cycloidea-like 7 [Gerbera hybrid cultivar] Length = 311 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/44 (54%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +3 Query: 321 HGFHPPSGFFSGQEKDGGYYNHHPFVAQDCSFNHAPL--PPPPP 446 HGF PPS F G E D Y+ HHPF+ DCSF+ + PPPPP Sbjct: 13 HGFPPPSASFFGHENDDVYFTHHPFLVGDCSFHDGNVIAPPPPP 56 >ref|XP_023748106.1| transcription factor CYCLOIDEA-like [Lactuca sativa] gb|PLY62922.1| hypothetical protein LSAT_3X94461 [Lactuca sativa] Length = 300 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = +3 Query: 321 HGFHPPSGFFSGQEKDGGYYNHHPFVAQDCSFNHAPLPPP 440 +GF S F GQEKDG ++NHHPF+A DCSF+H P P Sbjct: 13 NGFPHSSTVFFGQEKDGVHFNHHPFIAGDCSFDHVQTPLP 52