BLASTX nr result
ID: Chrysanthemum21_contig00044265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00044265 (517 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI02570.1| Cyclophilin-like peptidyl-prolyl cis-trans isomer... 65 3e-09 gb|AFK37973.1| unknown [Lotus japonicus] 63 6e-09 gb|PNY05203.1| peptidyl-prolyl cis-trans isomerase chloroplastic... 64 9e-09 ref|XP_015967082.1| peptidyl-prolyl cis-trans isomerase CYP38, c... 63 3e-08 gb|PRQ53878.1| putative peptidylprolyl isomerase [Rosa chinensis] 61 4e-08 dbj|GAU49231.1| hypothetical protein TSUD_282820 [Trifolium subt... 62 5e-08 ref|XP_013450814.1| peptidyl-prolyl cis-trans isomerase [Medicag... 62 5e-08 ref|XP_016203279.1| peptidyl-prolyl cis-trans isomerase CYP38, c... 62 6e-08 gb|PRQ53870.1| putative peptidylprolyl isomerase [Rosa chinensis] 58 8e-08 ref|XP_014516365.1| peptidyl-prolyl cis-trans isomerase CYP38, c... 61 9e-08 ref|XP_024182560.1| peptidyl-prolyl cis-trans isomerase CYP38, c... 61 1e-07 ref|XP_019442577.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 1e-07 ref|XP_019442576.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 1e-07 ref|XP_004489294.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 1e-07 gb|OIW12404.1| hypothetical protein TanjilG_04153 [Lupinus angus... 61 1e-07 gb|OIW06671.1| hypothetical protein TanjilG_04065 [Lupinus angus... 60 2e-07 ref|XP_019452882.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 60 2e-07 ref|XP_019452880.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 60 2e-07 ref|XP_021819209.1| peptidyl-prolyl cis-trans isomerase CYP38, c... 59 4e-07 ref|XP_021819140.1| peptidyl-prolyl cis-trans isomerase CYP38, c... 59 4e-07 >gb|KVI02570.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain-containing protein [Cynara cardunculus var. scolymus] Length = 400 Score = 65.5 bits (158), Expect = 3e-09 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L +G ITG+ +G P+NA+AI P L+DL +LIS P IKD GALLRYA I+N AI Sbjct: 90 LAIGLITGVPTLGFPSNADAITPALSDLAVLISGPPIKDPGALLRYALPIDNKAI 144 >gb|AFK37973.1| unknown [Lotus japonicus] Length = 212 Score = 63.2 bits (152), Expect = 6e-09 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG +TG+ +G P +ANA PVL+DL +LIS P IKD GALLRYA I+N A+ Sbjct: 65 LAVGLVTGVPTLGWPTDANAASPVLSDLSVLISGPPIKDPGALLRYALPIDNKAV 119 >gb|PNY05203.1| peptidyl-prolyl cis-trans isomerase chloroplastic-like [Trifolium pratense] Length = 394 Score = 63.9 bits (154), Expect = 9e-09 Identities = 34/55 (61%), Positives = 40/55 (72%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ +G PNNA+A VL+DL +LIS P IKD GALLRYA I+N AI Sbjct: 21 LAVGLITGVPTLGQPNNAHAANSVLSDLSVLISGPPIKDPGALLRYALPIDNKAI 75 >ref|XP_015967082.1| peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic [Arachis duranensis] Length = 454 Score = 62.8 bits (151), Expect = 3e-08 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ A+G P NA+ PVL DL +LIS P IKD GALLRYA I+N AI Sbjct: 81 LAVGLITGVPALGLPANAHTASPVLPDLAVLISGPPIKDPGALLRYALPIDNKAI 135 >gb|PRQ53878.1| putative peptidylprolyl isomerase [Rosa chinensis] Length = 209 Score = 60.8 bits (146), Expect = 4e-08 Identities = 34/55 (61%), Positives = 38/55 (69%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ A+ NNA A PVL DL +LIS P IKD GALLRYA I+N AI Sbjct: 61 LTVGLITGVPALELSNNAYAATPVLPDLSVLISGPPIKDPGALLRYALPIDNKAI 115 >dbj|GAU49231.1| hypothetical protein TSUD_282820 [Trifolium subterraneum] Length = 450 Score = 62.0 bits (149), Expect = 5e-08 Identities = 33/55 (60%), Positives = 40/55 (72%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ +G PN+A+A VL+DL +LIS P IKD GALLRYA I+N AI Sbjct: 80 LAVGLITGVPTLGQPNDAHAANSVLSDLSVLISGPPIKDPGALLRYALPIDNKAI 134 >ref|XP_013450814.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gb|KEH24854.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula] Length = 455 Score = 62.0 bits (149), Expect = 5e-08 Identities = 33/55 (60%), Positives = 39/55 (70%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ +G PN+A+A PVL DL +LIS P IKD GALLRY I+N AI Sbjct: 82 LAVGLITGVPTLGLPNDAHAANPVLPDLSVLISGPPIKDPGALLRYGLPIDNKAI 136 >ref|XP_016203279.1| peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic [Arachis ipaensis] Length = 454 Score = 61.6 bits (148), Expect = 6e-08 Identities = 33/55 (60%), Positives = 39/55 (70%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG +TG+ A+G P NA+ PVL DL +LIS P IKD GALLRYA I+N AI Sbjct: 81 LAVGLMTGVPALGLPANAHTTSPVLPDLAVLISGPPIKDPGALLRYALPIDNKAI 135 >gb|PRQ53870.1| putative peptidylprolyl isomerase [Rosa chinensis] Length = 116 Score = 58.2 bits (139), Expect = 8e-08 Identities = 33/55 (60%), Positives = 37/55 (67%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG I G+ A+ PNNA A VL DL +LIS P IKD GALLRYA I+N AI Sbjct: 14 LTVGLIIGVPALELPNNAYAATRVLPDLAVLISGPPIKDPGALLRYALPIDNKAI 68 >ref|XP_014516365.1| peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic [Vigna radiata var. radiata] Length = 445 Score = 61.2 bits (147), Expect = 9e-08 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ +GSP NA A V +DL +LIS P IKD GALLRYA I+N AI Sbjct: 72 LAVGLITGVPTLGSPTNAQAANSVFSDLSVLISGPPIKDPGALLRYALPIDNKAI 126 >ref|XP_024182560.1| peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic-like [Rosa chinensis] Length = 434 Score = 60.8 bits (146), Expect = 1e-07 Identities = 34/55 (61%), Positives = 38/55 (69%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ A+ NNA A PVL DL +LIS P IKD GALLRYA I+N AI Sbjct: 61 LTVGLITGVPALELSNNAYAATPVLPDLSVLISGPPIKDPGALLRYALPIDNKAI 115 >ref|XP_019442577.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic-like isoform X2 [Lupinus angustifolius] Length = 448 Score = 60.8 bits (146), Expect = 1e-07 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ G P +A+A PVL DL +LIS P IKD GALLRYA I+N AI Sbjct: 75 LAVGLITGVPTFGCPTDAHAANPVLPDLSVLISGPPIKDPGALLRYALPIDNKAI 129 >ref|XP_019442576.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic-like isoform X1 [Lupinus angustifolius] Length = 450 Score = 60.8 bits (146), Expect = 1e-07 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ G P +A+A PVL DL +LIS P IKD GALLRYA I+N AI Sbjct: 77 LAVGLITGVPTFGCPTDAHAANPVLPDLSVLISGPPIKDPGALLRYALPIDNKAI 131 >ref|XP_004489294.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic [Cicer arietinum] Length = 454 Score = 60.8 bits (146), Expect = 1e-07 Identities = 34/55 (61%), Positives = 37/55 (67%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ G PNNA A VL DL +LIS P IKD GALLRYA I+N AI Sbjct: 81 LAVGLITGVPTFGWPNNAGAANSVLPDLSVLISGPPIKDPGALLRYALPIDNKAI 135 >gb|OIW12404.1| hypothetical protein TanjilG_04153 [Lupinus angustifolius] Length = 620 Score = 60.8 bits (146), Expect = 1e-07 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ G P +A+A PVL DL +LIS P IKD GALLRYA I+N AI Sbjct: 247 LAVGLITGVPTFGCPTDAHAANPVLPDLSVLISGPPIKDPGALLRYALPIDNKAI 301 >gb|OIW06671.1| hypothetical protein TanjilG_04065 [Lupinus angustifolius] Length = 418 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ G P +A+A PVL DL +LIS P IKD GALLRYA I+N AI Sbjct: 69 LAVGLITGVPTFGCPIDADAASPVLPDLSVLISGPPIKDPGALLRYALPIDNKAI 123 >ref|XP_019452882.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like isoform X2 [Lupinus angustifolius] Length = 429 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ G P +A+A PVL DL +LIS P IKD GALLRYA I+N AI Sbjct: 56 LAVGLITGVPTFGCPIDADAASPVLPDLSVLISGPPIKDPGALLRYALPIDNKAI 110 >ref|XP_019452880.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic-like isoform X1 [Lupinus angustifolius] ref|XP_019452881.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic-like isoform X1 [Lupinus angustifolius] Length = 442 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG ITG+ G P +A+A PVL DL +LIS P IKD GALLRYA I+N AI Sbjct: 69 LAVGLITGVPTFGCPIDADAASPVLPDLSVLISGPPIKDPGALLRYALPIDNKAI 123 >ref|XP_021819209.1| peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic isoform X4 [Prunus avium] ref|XP_021819346.1| peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic isoform X6 [Prunus avium] Length = 445 Score = 59.3 bits (142), Expect = 4e-07 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG +TG+ A+ +NA A PVL DL +LIS P IKD GALLRYA INN AI Sbjct: 72 LAVGLVTGVPALDWSSNAYAANPVLPDLSVLISGPPIKDPGALLRYALPINNKAI 126 >ref|XP_021819140.1| peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic isoform X3 [Prunus avium] ref|XP_021819277.1| peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic isoform X5 [Prunus avium] Length = 446 Score = 59.3 bits (142), Expect = 4e-07 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -1 Query: 517 LLVGFITGLLAMGSPNNANAIVPVLTDLPMLISRPSIKDLGALLRYACRINNNAI 353 L VG +TG+ A+ +NA A PVL DL +LIS P IKD GALLRYA INN AI Sbjct: 73 LAVGLVTGVPALDWSSNAYAANPVLPDLSVLISGPPIKDPGALLRYALPINNKAI 127