BLASTX nr result
ID: Chrysanthemum21_contig00044102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00044102 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI06375.1| hemerythrin/HHE cation-binding motif-containing p... 98 9e-21 ref|XP_023734229.1| zinc finger protein BRUTUS-like At1g18910 is... 92 1e-18 ref|XP_021983950.1| zinc finger protein BRUTUS-like At1g18910 [H... 80 2e-14 >gb|KVI06375.1| hemerythrin/HHE cation-binding motif-containing protein [Cynara cardunculus var. scolymus] Length = 1071 Score = 98.2 bits (243), Expect = 9e-21 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = +2 Query: 305 LMSEFELTIIPGDRLRESPILLLLHFHNALREELGDLRRTAAEALDSRTYGPDLIQE 475 LMS FELT IPG RLR++PILLLLHFHNALREEL DLRRTAA+ALDSR YGPDLIQE Sbjct: 6 LMSAFELTEIPGVRLRQAPILLLLHFHNALREELADLRRTAADALDSRIYGPDLIQE 62 >ref|XP_023734229.1| zinc finger protein BRUTUS-like At1g18910 isoform X1 [Lactuca sativa] ref|XP_023734230.1| zinc finger protein BRUTUS-like At1g18910 isoform X1 [Lactuca sativa] gb|PLY73457.1| hypothetical protein LSAT_4X106820 [Lactuca sativa] Length = 1187 Score = 92.0 bits (227), Expect = 1e-18 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = +2 Query: 305 LMSEFELTIIPGDRLRESPILLLLHFHNALREELGDLRRTAAEALDSRTYGPDLIQE 475 + S FEL +IPG RLRE+P+LLLLHFHNALREE+ DLRRTAAEALDSR YG DLIQE Sbjct: 1 MSSAFELAVIPGVRLREAPVLLLLHFHNALREEVTDLRRTAAEALDSRIYGVDLIQE 57 >ref|XP_021983950.1| zinc finger protein BRUTUS-like At1g18910 [Helianthus annuus] gb|OTG16432.1| putative zinc ion binding,zinc ion binding protein [Helianthus annuus] Length = 1194 Score = 80.1 bits (196), Expect = 2e-14 Identities = 41/56 (73%), Positives = 43/56 (76%) Frame = +2 Query: 308 MSEFELTIIPGDRLRESPILLLLHFHNALREELGDLRRTAAEALDSRTYGPDLIQE 475 MS LT+IPG RLRE+PILLLLHFHNALR EL L R EALD RTYGPDLI E Sbjct: 1 MSVSVLTVIPGARLREAPILLLLHFHNALRLELAYLHRIVVEALDGRTYGPDLIPE 56