BLASTX nr result
ID: Chrysanthemum21_contig00043957
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00043957 (468 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG31133.1| putative kinesin motor domain-containing protein ... 57 3e-06 ref|XP_022028220.1| kinesin-like protein KIN-12D [Helianthus ann... 57 3e-06 >gb|OTG31133.1| putative kinesin motor domain-containing protein [Helianthus annuus] Length = 2502 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 5/57 (8%) Frame = -3 Query: 448 VRLSEKQSRENIEVLFPQVLALKYVVDHFEKQIGVAMVYLDN*IP-----LRKLCRN 293 +RLSEKQSR++IE PQVLAL+ +D+FEKQ VAMV LDN I L+K C++ Sbjct: 1292 IRLSEKQSRQSIEGFVPQVLALQATLDNFEKQTEVAMVSLDNKIQTVEGLLQKSCKS 1348 >ref|XP_022028220.1| kinesin-like protein KIN-12D [Helianthus annuus] Length = 2509 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 5/57 (8%) Frame = -3 Query: 448 VRLSEKQSRENIEVLFPQVLALKYVVDHFEKQIGVAMVYLDN*IP-----LRKLCRN 293 +RLSEKQSR++IE PQVLAL+ +D+FEKQ VAMV LDN I L+K C++ Sbjct: 1299 IRLSEKQSRQSIEGFVPQVLALQATLDNFEKQTEVAMVSLDNKIQTVEGLLQKSCKS 1355