BLASTX nr result
ID: Chrysanthemum21_contig00043652
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00043652 (468 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023760823.1| probable sulfate transporter 3.4 [Lactuca sa... 60 2e-07 gb|OTG27069.1| putative SLC26A/SulP transporter [Helianthus annuus] 59 5e-07 ref|XP_022033650.1| probable sulfate transporter 3.4 [Helianthus... 59 5e-07 >ref|XP_023760823.1| probable sulfate transporter 3.4 [Lactuca sativa] gb|PLY98590.1| hypothetical protein LSAT_1X34940 [Lactuca sativa] Length = 665 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 412 QLHKGLNPHS*NTLYFHGEFLAVAVKTDAVVGLLSLTQ 299 QL KGLNP S + LYFHGEFLAVAVKT AV GLLSLT+ Sbjct: 326 QLKKGLNPSSLDMLYFHGEFLAVAVKTGAVTGLLSLTE 363 >gb|OTG27069.1| putative SLC26A/SulP transporter [Helianthus annuus] Length = 621 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -3 Query: 412 QLHKGLNPHS*NTLYFHGEFLAVAVKTDAVVGLLSLTQ 299 QL KG+NP S N LYFHGEFLAVAVKT V GLLSLT+ Sbjct: 317 QLDKGVNPPSSNMLYFHGEFLAVAVKTGVVTGLLSLTE 354 >ref|XP_022033650.1| probable sulfate transporter 3.4 [Helianthus annuus] Length = 631 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -3 Query: 412 QLHKGLNPHS*NTLYFHGEFLAVAVKTDAVVGLLSLTQ 299 QL KG+NP S N LYFHGEFLAVAVKT V GLLSLT+ Sbjct: 292 QLDKGVNPPSSNMLYFHGEFLAVAVKTGVVTGLLSLTE 329