BLASTX nr result
ID: Chrysanthemum21_contig00043236
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00043236 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022021663.1| uncharacterized protein LOC110921625 [Helian... 56 2e-06 ref|XP_022023253.1| uncharacterized protein LOC110923473 [Helian... 55 3e-06 >ref|XP_022021663.1| uncharacterized protein LOC110921625 [Helianthus annuus] gb|OTF85242.1| putative PB1 domain, Zinc finger, Dof-type, ALOG domain protein [Helianthus annuus] Length = 429 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/67 (41%), Positives = 39/67 (58%) Frame = -3 Query: 205 LIQFWQCSSPQGSKANGFDVTTEGQPFHIPQPNSYLDRYRKSCVDKGCTFVGQNTGVGKW 26 L+QFW+ S+P S G ++ Q F + P+ L+ YR+ C++ C FVG T VG W Sbjct: 205 LLQFWE-STPSNSDDMGCNLMLTDQTF-MSAPDKGLEEYRRRCLESRCRFVGLETSVGNW 262 Query: 25 LVGRAIQ 5 L GRA Q Sbjct: 263 LAGRAAQ 269 >ref|XP_022023253.1| uncharacterized protein LOC110923473 [Helianthus annuus] Length = 265 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = -3 Query: 205 LIQFWQCSSPQGSKANGFDVTTEGQPFHIPQPNS-YLDRYRKSCVDKGCTFVGQNTGVGK 29 L+QFW+C + S+ G +T Q + + + + L YR+ C++ C FVG T VGK Sbjct: 34 LLQFWECITASDSEEIGCYLTLTEQTYMLTRDHEGLLQDYRRRCLESRCRFVGVETKVGK 93 Query: 28 WLVGRAIQ 5 WL GRA Q Sbjct: 94 WLPGRAAQ 101