BLASTX nr result
ID: Chrysanthemum21_contig00043209
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00043209 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH91221.1| Crotonase superfamily [Cynara cardunculus var. sc... 50 7e-06 >gb|KVH91221.1| Crotonase superfamily [Cynara cardunculus var. scolymus] Length = 589 Score = 49.7 bits (117), Expect(2) = 7e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 176 LVDDPHAPVQVEVNAHSRSVVLNRPSYLNALNIQMICRL 292 L DDP + V VE NA SR+VVLNRPS+LNALN M RL Sbjct: 46 LTDDPDSSVLVEGNAGSRTVVLNRPSFLNALNTSMGSRL 84 Score = 27.7 bits (60), Expect(2) = 7e-06 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 352 RLHKLYESWED 384 RLHKLY+SWED Sbjct: 83 RLHKLYKSWED 93