BLASTX nr result
ID: Chrysanthemum21_contig00042933
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00042933 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022036003.1| protein MOR1 [Helianthus annuus] >gi|1191677... 61 3e-08 gb|KVH89565.1| hypothetical protein Ccrd_008447 [Cynara carduncu... 58 3e-07 ref|XP_022000216.1| protein MOR1-like [Helianthus annuus] >gi|12... 56 5e-07 gb|OTG00662.1| putative armadillo-type fold protein [Helianthus ... 56 1e-06 gb|PLY73796.1| hypothetical protein LSAT_7X48800 [Lactuca sativa] 56 2e-06 ref|XP_023733836.1| protein MOR1-like [Lactuca sativa] 56 2e-06 >ref|XP_022036003.1| protein MOR1 [Helianthus annuus] gb|OTG29595.1| putative ARM repeat superfamily protein [Helianthus annuus] Length = 2014 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +1 Query: 187 ISVCHQDKSTNVRQAAEVCFGDIVRVCGAEMVMKNV*DIQ 306 ++V DKS +VR+AAE CFGDIVRVCG EMVMKNV DIQ Sbjct: 1016 VAVAMTDKSADVRKAAEACFGDIVRVCGPEMVMKNVRDIQ 1055 >gb|KVH89565.1| hypothetical protein Ccrd_008447 [Cynara cardunculus var. scolymus] Length = 1810 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 187 ISVCHQDKSTNVRQAAEVCFGDIVRVCGAEMVMKNV*DIQ 306 ++V DKS +VR+AAE CFG+IVRVCG E+VMKNV DIQ Sbjct: 939 VAVAMTDKSVDVRKAAEACFGEIVRVCGPEVVMKNVRDIQ 978 >ref|XP_022000216.1| protein MOR1-like [Helianthus annuus] ref|XP_022000217.1| protein MOR1-like [Helianthus annuus] ref|XP_022000218.1| protein MOR1-like [Helianthus annuus] ref|XP_022000219.1| protein MOR1-like [Helianthus annuus] Length = 190 Score = 56.2 bits (134), Expect = 5e-07 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 187 ISVCHQDKSTNVRQAAEVCFGDIVRVCGAEMVMKNV*DIQ 306 ++V DKS +VR+AAE C DIVRVCG EMVMKNV DIQ Sbjct: 87 VAVSMMDKSADVRKAAEACLRDIVRVCGTEMVMKNVRDIQ 126 >gb|OTG00662.1| putative armadillo-type fold protein [Helianthus annuus] Length = 333 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 187 ISVCHQDKSTNVRQAAEVCFGDIVRVCGAEMVMKNV*DIQ 306 ++V DKS +VR+AAE C DIVRVCG EMVMKNV DIQ Sbjct: 230 VAVSMMDKSADVRKAAEACLRDIVRVCGTEMVMKNVRDIQ 269 >gb|PLY73796.1| hypothetical protein LSAT_7X48800 [Lactuca sativa] Length = 1604 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 187 ISVCHQDKSTNVRQAAEVCFGDIVRVCGAEMVMKNV*DIQ 306 +++ DKS +VR+AAE FG++VRVCGAEMVMKNV DIQ Sbjct: 1011 VAIAMTDKSVDVRKAAETFFGELVRVCGAEMVMKNVQDIQ 1050 >ref|XP_023733836.1| protein MOR1-like [Lactuca sativa] Length = 1660 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 187 ISVCHQDKSTNVRQAAEVCFGDIVRVCGAEMVMKNV*DIQ 306 +++ DKS +VR+AAE FG++VRVCGAEMVMKNV DIQ Sbjct: 1011 VAIAMTDKSVDVRKAAETFFGELVRVCGAEMVMKNVQDIQ 1050