BLASTX nr result
ID: Chrysanthemum21_contig00042795
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00042795 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF86663.1| putative WD40/YVTN repeat-like-containing domain,... 59 3e-08 gb|PLY86784.1| hypothetical protein LSAT_5X8840 [Lactuca sativa] 59 2e-07 ref|XP_021984316.1| topless-related protein 1-like [Helianthus a... 59 2e-07 ref|XP_023762146.1| LOW QUALITY PROTEIN: protein TOPLESS-like [L... 59 2e-07 ref|XP_017180699.1| PREDICTED: LOW QUALITY PROTEIN: protein TOPL... 59 3e-07 ref|XP_022039236.1| protein TOPLESS-like [Helianthus annuus] >gi... 59 4e-07 gb|KVH98059.1| CTLH, C-terminal LisH motif-containing protein [C... 58 5e-07 ref|XP_013465574.1| topless-like protein [Medicago truncatula] >... 58 5e-07 ref|XP_003597931.2| topless-like protein [Medicago truncatula] >... 58 5e-07 ref|XP_013465573.1| topless-like protein [Medicago truncatula] >... 58 5e-07 ref|XP_003597932.2| topless-like protein [Medicago truncatula] >... 58 5e-07 ref|XP_004486641.1| PREDICTED: topless-related protein 1-like is... 58 5e-07 ref|XP_003597933.1| topless-like protein [Medicago truncatula] >... 58 5e-07 ref|XP_004486640.1| PREDICTED: topless-related protein 1-like is... 58 5e-07 ref|XP_022033780.1| topless-related protein 1-like isoform X3 [H... 58 7e-07 ref|XP_022033779.1| topless-related protein 1-like isoform X2 [H... 58 7e-07 ref|XP_010097168.1| protein TOPLESS [Morus notabilis] >gi|135025... 58 7e-07 ref|XP_022033777.1| topless-related protein 1-like isoform X1 [H... 58 7e-07 gb|OTF90494.1| putative CTLH LisH motif-containing protein [Heli... 57 1e-06 gb|PON51665.1| Topless-like WD40 repeat containing protein [Para... 57 1e-06 >gb|OTF86663.1| putative WD40/YVTN repeat-like-containing domain, Topless family [Helianthus annuus] Length = 161 Score = 59.3 bits (142), Expect = 3e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WEVGSR KLVLKN+KVW+LS CSM FQ ++ Sbjct: 7 VGDIGLWEVGSREKLVLKNFKVWNLSACSMPFQAALV 43 >gb|PLY86784.1| hypothetical protein LSAT_5X8840 [Lactuca sativa] Length = 1123 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WEVGSR KLVLKN+KVWDLS CSM Q ++ Sbjct: 394 VGDIGLWEVGSREKLVLKNFKVWDLSSCSMPMQAALV 430 >ref|XP_021984316.1| topless-related protein 1-like [Helianthus annuus] gb|OTG16746.1| putative LIS1 homology motif protein [Helianthus annuus] Length = 1132 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WEVGSR KLVLKN+KVW+LS CSM FQ ++ Sbjct: 375 VGDIGLWEVGSREKLVLKNFKVWNLSACSMPFQAALV 411 >ref|XP_023762146.1| LOW QUALITY PROTEIN: protein TOPLESS-like [Lactuca sativa] Length = 1152 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WEVGSR KLVLKN+KVWDLS CSM Q ++ Sbjct: 394 VGDIGLWEVGSREKLVLKNFKVWDLSSCSMPMQAALV 430 >ref|XP_017180699.1| PREDICTED: LOW QUALITY PROTEIN: protein TOPLESS-like [Malus domestica] Length = 499 Score = 58.5 bits (140), Expect = 3e-07 Identities = 29/62 (46%), Positives = 37/62 (59%), Gaps = 11/62 (17%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVV-----------VMYCIDGHMVGLYE 257 V D+G WEVGSR +LVL+N+KVWDLS CSM Q V++ DG + G +E Sbjct: 415 VGDVGLWEVGSRERLVLRNFKVWDLSSCSMLLQAALVKDAGVSVNRVIWSSDGALFGCWE 474 Query: 256 PL 251 L Sbjct: 475 QL 476 >ref|XP_022039236.1| protein TOPLESS-like [Helianthus annuus] gb|OTG26268.1| putative transducin family protein / WD-40 repeat family protein [Helianthus annuus] Length = 1135 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WEVGSR KLV KN+KVWDLS CSMS Q ++ Sbjct: 376 VGDIGLWEVGSRDKLVSKNFKVWDLSTCSMSLQAALV 412 >gb|KVH98059.1| CTLH, C-terminal LisH motif-containing protein [Cynara cardunculus var. scolymus] Length = 946 Score = 58.2 bits (139), Expect = 5e-07 Identities = 30/54 (55%), Positives = 35/54 (64%), Gaps = 7/54 (12%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQV-------VVMYCIDGHMVGL 263 V DIG WEVGSR KLVL+N+KVWDLS CSM Q V + ID H+ G+ Sbjct: 345 VGDIGLWEVGSRDKLVLRNFKVWDLSACSMPMQAALVKDPGVSVNRIDAHVGGV 398 >ref|XP_013465574.1| topless-like protein [Medicago truncatula] gb|KEH39610.1| topless-like protein [Medicago truncatula] Length = 1111 Score = 58.2 bits (139), Expect = 5e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WE+GSR +LVL+N+KVWDLS CSM FQ ++ Sbjct: 356 VADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALV 392 >ref|XP_003597931.2| topless-like protein [Medicago truncatula] gb|AES68182.2| topless-like protein [Medicago truncatula] Length = 1126 Score = 58.2 bits (139), Expect = 5e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WE+GSR +LVL+N+KVWDLS CSM FQ ++ Sbjct: 371 VADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALV 407 >ref|XP_013465573.1| topless-like protein [Medicago truncatula] gb|KEH39609.1| topless-like protein [Medicago truncatula] Length = 1133 Score = 58.2 bits (139), Expect = 5e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WE+GSR +LVL+N+KVWDLS CSM FQ ++ Sbjct: 378 VADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALV 414 >ref|XP_003597932.2| topless-like protein [Medicago truncatula] gb|AES68183.2| topless-like protein [Medicago truncatula] Length = 1148 Score = 58.2 bits (139), Expect = 5e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WE+GSR +LVL+N+KVWDLS CSM FQ ++ Sbjct: 393 VADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALV 429 >ref|XP_004486641.1| PREDICTED: topless-related protein 1-like isoform X2 [Cicer arietinum] Length = 1149 Score = 58.2 bits (139), Expect = 5e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WE+GSR +LVL+N+KVWDLS CSM FQ ++ Sbjct: 380 VADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALV 416 >ref|XP_003597933.1| topless-like protein [Medicago truncatula] gb|AES68184.1| topless-like protein [Medicago truncatula] Length = 1149 Score = 58.2 bits (139), Expect = 5e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WE+GSR +LVL+N+KVWDLS CSM FQ ++ Sbjct: 393 VADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALV 429 >ref|XP_004486640.1| PREDICTED: topless-related protein 1-like isoform X1 [Cicer arietinum] Length = 1150 Score = 58.2 bits (139), Expect = 5e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WE+GSR +LVL+N+KVWDLS CSM FQ ++ Sbjct: 380 VADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALV 416 >ref|XP_022033780.1| topless-related protein 1-like isoform X3 [Helianthus annuus] Length = 1107 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WEVGSR KLVL+N+KVWDLS CSM Q ++ Sbjct: 377 VGDIGLWEVGSRDKLVLRNFKVWDLSACSMPMQAALV 413 >ref|XP_022033779.1| topless-related protein 1-like isoform X2 [Helianthus annuus] gb|OTG27253.1| putative LIS1 homology motif protein [Helianthus annuus] Length = 1137 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WEVGSR KLVL+N+KVWDLS CSM Q ++ Sbjct: 377 VGDIGLWEVGSRDKLVLRNFKVWDLSACSMPMQAALV 413 >ref|XP_010097168.1| protein TOPLESS [Morus notabilis] ref|XP_024021872.1| protein TOPLESS [Morus notabilis] ref|XP_024021873.1| protein TOPLESS [Morus notabilis] gb|EXB67235.1| Protein TOPLESS [Morus notabilis] Length = 1138 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WEVGSR +LVLKN+KVWDLS CSM Q ++ Sbjct: 377 VGDIGLWEVGSRERLVLKNFKVWDLSTCSMPLQAALV 413 >ref|XP_022033777.1| topless-related protein 1-like isoform X1 [Helianthus annuus] ref|XP_022033778.1| topless-related protein 1-like isoform X1 [Helianthus annuus] Length = 1139 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WEVGSR KLVL+N+KVWDLS CSM Q ++ Sbjct: 377 VGDIGLWEVGSRDKLVLRNFKVWDLSACSMPMQAALV 413 >gb|OTF90494.1| putative CTLH LisH motif-containing protein [Helianthus annuus] Length = 1117 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WEVGSR KLVLKN+KVW+LS CS+S Q ++ Sbjct: 355 VGDIGLWEVGSREKLVLKNFKVWNLSACSVSLQAALV 391 >gb|PON51665.1| Topless-like WD40 repeat containing protein [Parasponia andersonii] Length = 1130 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 403 VEDIGFWEVGSRSKLVLKNYKVWDLSECSMSFQVVVM 293 V DIG WEVGSR +LVL+N+KVWDLS CSM+ Q ++ Sbjct: 374 VGDIGLWEVGSRERLVLRNFKVWDLSACSMALQAALV 410