BLASTX nr result
ID: Chrysanthemum21_contig00042590
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00042590 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021981981.1| auxin-responsive protein IAA13 [Helianthus a... 64 1e-09 gb|ANS54464.1| indole-3-acetic acid inducible 12, partial [Chrys... 61 2e-09 gb|OTG37823.1| putative PB1 domain, AUX/IAA protein [Helianthus ... 64 2e-09 ref|XP_021994018.1| auxin-responsive protein IAA13-like [Heliant... 61 1e-08 gb|KVI00421.1| Aux/IAA-ARF-dimerization [Cynara cardunculus var.... 61 1e-08 gb|OVA02312.1| AUX/IAA protein [Macleaya cordata] 61 2e-08 gb|PLY70605.1| hypothetical protein LSAT_1X75561 [Lactuca sativa] 59 3e-08 gb|ERN15874.1| hypothetical protein AMTR_s00039p00196100 [Ambore... 60 3e-08 gb|ADG60258.1| IAA13-like protein, partial [Nicotiana tabacum] 59 4e-08 ref|XP_022771344.1| auxin-responsive protein IAA12-like [Durio z... 57 4e-08 gb|KZM85226.1| hypothetical protein DCAR_027352 [Daucus carota s... 59 4e-08 ref|XP_017220635.1| PREDICTED: auxin-responsive protein IAA12 [D... 59 9e-08 ref|XP_006854407.2| auxin-responsive protein IAA12 [Amborella tr... 60 1e-07 ref|XP_010264857.1| PREDICTED: auxin-responsive protein IAA12-li... 60 1e-07 ref|XP_019054229.1| PREDICTED: auxin-responsive protein IAA12-li... 60 1e-07 ref|XP_009767833.1| PREDICTED: auxin-responsive protein IAA11-li... 59 1e-07 ref|XP_019248190.1| PREDICTED: auxin-responsive protein IAA12-li... 59 1e-07 ref|XP_019248189.1| PREDICTED: auxin-responsive protein IAA13-li... 59 1e-07 ref|XP_009767832.1| PREDICTED: auxin-responsive protein IAA12-li... 59 1e-07 ref|XP_009767831.1| PREDICTED: auxin-responsive protein IAA12-li... 59 1e-07 >ref|XP_021981981.1| auxin-responsive protein IAA13 [Helianthus annuus] Length = 218 Score = 64.3 bits (155), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 101 KHQSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 KHQ S +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 145 KHQRSRLLDGSSEFVLTYEDKEGDWMLVGDVP 176 >gb|ANS54464.1| indole-3-acetic acid inducible 12, partial [Chrysanthemum x morifolium] Length = 105 Score = 61.2 bits (147), Expect = 2e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 101 KHQSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 K Q S +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 39 KQQRSRLLDGSSEFVLTYEDKEGDWMLVGDVP 70 >gb|OTG37823.1| putative PB1 domain, AUX/IAA protein [Helianthus annuus] Length = 291 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 101 KHQSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 KHQ S +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 218 KHQRSRLLDGSSEFVLTYEDKEGDWMLVGDVP 249 >ref|XP_021994018.1| auxin-responsive protein IAA13-like [Helianthus annuus] gb|OTG08497.1| putative PB1 domain, AUX/IAA protein [Helianthus annuus] Length = 217 Score = 61.2 bits (147), Expect = 1e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 101 KHQSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 K Q S +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 146 KQQRSRLLDGSSEFVLTYEDKEGDWMLVGDVP 177 >gb|KVI00421.1| Aux/IAA-ARF-dimerization [Cynara cardunculus var. scolymus] Length = 224 Score = 61.2 bits (147), Expect = 1e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 101 KHQSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 K Q S +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 151 KQQHSRLLDGSSEFVLTYEDKEGDWMLVGDVP 182 >gb|OVA02312.1| AUX/IAA protein [Macleaya cordata] Length = 281 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 101 KHQSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 K SS +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 212 KEHSSKLLDGSSEFVLTYEDKEGDWMLVGDVP 243 >gb|PLY70605.1| hypothetical protein LSAT_1X75561 [Lactuca sativa] Length = 157 Score = 59.3 bits (142), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 95 QSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 Q S +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 102 QRSRLLDGSSEFVLTYEDKEGDWMLVGDVP 131 >gb|ERN15874.1| hypothetical protein AMTR_s00039p00196100 [Amborella trichopoda] Length = 183 Score = 59.7 bits (143), Expect = 3e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 104 IKHQSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 ++ ++S +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 113 VESKASKLLDGSSEFVLTYEDKEGDWMLVGDVP 145 >gb|ADG60258.1| IAA13-like protein, partial [Nicotiana tabacum] Length = 170 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 92 SSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 SS +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 102 SSRLLDGSSEFVLTYEDKEGDWMLVGDVP 130 >ref|XP_022771344.1| auxin-responsive protein IAA12-like [Durio zibethinus] Length = 74 Score = 57.0 bits (136), Expect = 4e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 95 QSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 +SS +LDGSS+FVLTY+DKEGDWMLVGDVP Sbjct: 7 RSSKLLDGSSDFVLTYKDKEGDWMLVGDVP 36 >gb|KZM85226.1| hypothetical protein DCAR_027352 [Daucus carota subsp. sativus] Length = 176 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 95 QSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 Q S +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 106 QPSKLLDGSSEFVLTYEDKEGDWMLVGDVP 135 >ref|XP_017220635.1| PREDICTED: auxin-responsive protein IAA12 [Daucus carota subsp. sativus] Length = 250 Score = 59.3 bits (142), Expect = 9e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 95 QSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 Q S +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 180 QPSKLLDGSSEFVLTYEDKEGDWMLVGDVP 209 >ref|XP_006854407.2| auxin-responsive protein IAA12 [Amborella trichopoda] Length = 326 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 104 IKHQSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 ++ ++S +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 256 VESKASKLLDGSSEFVLTYEDKEGDWMLVGDVP 288 >ref|XP_010264857.1| PREDICTED: auxin-responsive protein IAA12-like isoform X2 [Nelumbo nucifera] Length = 332 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 95 QSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 +SS +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 258 KSSRLLDGSSEFVLTYEDKEGDWMLVGDVP 287 >ref|XP_019054229.1| PREDICTED: auxin-responsive protein IAA12-like isoform X1 [Nelumbo nucifera] Length = 333 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 95 QSSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 +SS +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 259 KSSRLLDGSSEFVLTYEDKEGDWMLVGDVP 288 >ref|XP_009767833.1| PREDICTED: auxin-responsive protein IAA11-like isoform X4 [Nicotiana sylvestris] ref|XP_016455010.1| PREDICTED: auxin-responsive protein IAA11-like isoform X3 [Nicotiana tabacum] Length = 285 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 92 SSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 SS +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 243 SSRLLDGSSEFVLTYEDKEGDWMLVGDVP 271 >ref|XP_019248190.1| PREDICTED: auxin-responsive protein IAA12-like isoform X2 [Nicotiana attenuata] Length = 302 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 92 SSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 SS +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 234 SSRLLDGSSEFVLTYEDKEGDWMLVGDVP 262 >ref|XP_019248189.1| PREDICTED: auxin-responsive protein IAA13-like isoform X1 [Nicotiana attenuata] Length = 304 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 92 SSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 SS +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 234 SSRLLDGSSEFVLTYEDKEGDWMLVGDVP 262 >ref|XP_009767832.1| PREDICTED: auxin-responsive protein IAA12-like isoform X3 [Nicotiana sylvestris] ref|XP_016455009.1| PREDICTED: auxin-responsive protein IAA12-like isoform X2 [Nicotiana tabacum] Length = 309 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 92 SSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 SS +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 243 SSRLLDGSSEFVLTYEDKEGDWMLVGDVP 271 >ref|XP_009767831.1| PREDICTED: auxin-responsive protein IAA12-like isoform X2 [Nicotiana sylvestris] ref|XP_016455008.1| PREDICTED: auxin-responsive protein IAA12-like isoform X1 [Nicotiana tabacum] Length = 311 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 92 SSWILDGSSEFVLTYEDKEGDWMLVGDVP 6 SS +LDGSSEFVLTYEDKEGDWMLVGDVP Sbjct: 243 SSRLLDGSSEFVLTYEDKEGDWMLVGDVP 271