BLASTX nr result
ID: Chrysanthemum21_contig00042583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00042583 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY70348.1| hypothetical protein LSAT_4X66041 [Lactuca sativa] 70 5e-13 gb|OTF84720.1| putative NADH:ubiquinone oxidoreductase, subunit ... 69 1e-12 gb|AHJ81035.1| orf142 (mitochondrion) [Panax ginseng] 69 3e-12 gb|PKI40647.1| hypothetical protein CRG98_038962 [Punica granatum] 65 7e-11 ref|YP_173402.1| hypothetical protein NitaMp056 [Nicotiana tabac... 65 7e-11 ref|XP_019260841.1| PREDICTED: uncharacterized protein LOC109238... 65 7e-11 ref|XP_016462209.1| PREDICTED: NADH-ubiquinone oxidoreductase ch... 65 7e-11 gb|EEF22256.1| NADH dehydrogenase, putative [Ricinus communis] >... 63 2e-10 gb|OAO89164.1| hypothetical protein AXX17_ATUG03670 (mitochondri... 61 2e-09 gb|EXC33548.1| putative mitochondrial protein [Morus notabilis] 65 2e-09 ref|YP_009228089.1| hypothetical protein AYB38_gp59 (mitochondri... 61 3e-09 ref|XP_019266604.1| PREDICTED: uncharacterized protein LOC109244... 61 3e-08 ref|XP_019261126.1| PREDICTED: uncharacterized protein LOC109239... 59 4e-08 emb|CDY45510.1| BnaCnng12690D [Brassica napus] 59 4e-08 ref|XP_024016261.1| uncharacterized protein LOC112089740 [Eutrem... 60 4e-08 gb|PHU11362.1| NADH-ubiquinone oxidoreductase chain 1 [Capsicum ... 56 6e-08 ref|YP_009306081.1| NADH dehydrogenase subunit 1 (mitochondrion)... 49 1e-07 ref|YP_009381499.1| hypothetical protein AEK19_MT1086 (mitochond... 55 1e-07 gb|PHT69462.1| NADH-ubiquinone oxidoreductase chain 1 [Capsicum ... 57 5e-07 ref|XP_015159342.1| PREDICTED: NADH-ubiquinone oxidoreductase ch... 55 9e-07 >gb|PLY70348.1| hypothetical protein LSAT_4X66041 [Lactuca sativa] Length = 97 Score = 69.7 bits (169), Expect = 5e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVSA 234 AEANVPGSRGLILTETRGGSLPT +SAILGKPKNVSA Sbjct: 61 AEANVPGSRGLILTETRGGSLPTFQSAILGKPKNVSA 97 >gb|OTF84720.1| putative NADH:ubiquinone oxidoreductase, subunit 1/F420H2 oxidoreductase subunit H (mitochondrion) [Helianthus annuus] gb|OTG17445.1| putative NADH:ubiquinone oxidoreductase, subunit 1/F420H2 oxidoreductase subunit H [Helianthus annuus] Length = 97 Score = 68.9 bits (167), Expect = 1e-12 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVSA 234 AEANVPGSRGLILTETRGGSLPT K AILGKPKNVSA Sbjct: 61 AEANVPGSRGLILTETRGGSLPTEKYAILGKPKNVSA 97 >gb|AHJ81035.1| orf142 (mitochondrion) [Panax ginseng] Length = 142 Score = 68.9 bits (167), Expect = 3e-12 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVSA 234 AEANVPGSRGLILTETRGGSLPT KS ILGKPKNVSA Sbjct: 106 AEANVPGSRGLILTETRGGSLPTSKSYILGKPKNVSA 142 >gb|PKI40647.1| hypothetical protein CRG98_038962 [Punica granatum] Length = 142 Score = 65.5 bits (158), Expect = 7e-11 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVSA 234 AEANVPGSRGLILTETRGGSLPT K +ILGKPK VSA Sbjct: 106 AEANVPGSRGLILTETRGGSLPTKKYSILGKPKKVSA 142 >ref|YP_173402.1| hypothetical protein NitaMp056 [Nicotiana tabacum] dbj|BAD83466.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 142 Score = 65.5 bits (158), Expect = 7e-11 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVSA 234 AEANVPGSRGLILTETRGGSLPT K +ILGKPK VSA Sbjct: 106 AEANVPGSRGLILTETRGGSLPTSKYSILGKPKKVSA 142 >ref|XP_019260841.1| PREDICTED: uncharacterized protein LOC109238817 [Nicotiana attenuata] Length = 142 Score = 65.5 bits (158), Expect = 7e-11 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVSA 234 AEANVPGSRGLILTETRGGSLPT K +ILGKPK VSA Sbjct: 106 AEANVPGSRGLILTETRGGSLPTSKYSILGKPKKVSA 142 >ref|XP_016462209.1| PREDICTED: NADH-ubiquinone oxidoreductase chain 1-like [Nicotiana tabacum] Length = 142 Score = 65.5 bits (158), Expect = 7e-11 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVSA 234 AEANVPGSRGLILTETRGGSLPT K +ILGKPK VSA Sbjct: 106 AEANVPGSRGLILTETRGGSLPTSKYSILGKPKKVSA 142 >gb|EEF22256.1| NADH dehydrogenase, putative [Ricinus communis] gb|EEF22869.1| NADH dehydrogenase, putative [Ricinus communis] gb|EEF27384.1| NADH dehydrogenase, putative [Ricinus communis] Length = 97 Score = 63.2 bits (152), Expect = 2e-10 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVSA 234 AEANVPGSRGLILTETRGGSLP K LGKPKNVSA Sbjct: 61 AEANVPGSRGLILTETRGGSLPISKKFYLGKPKNVSA 97 >gb|OAO89164.1| hypothetical protein AXX17_ATUG03670 (mitochondrion) [Arabidopsis thaliana] Length = 97 Score = 60.8 bits (146), Expect = 2e-09 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVSA 234 AEANVPGSRGLILTETRGGSLPT K +I GK KNV A Sbjct: 61 AEANVPGSRGLILTETRGGSLPTQKYSIFGKTKNVIA 97 >gb|EXC33548.1| putative mitochondrial protein [Morus notabilis] Length = 478 Score = 64.7 bits (156), Expect = 2e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVSA 234 AEANVPGS GLILTETRGGSLPT K +ILGKPKNVSA Sbjct: 403 AEANVPGSWGLILTETRGGSLPTSKYSILGKPKNVSA 439 >ref|YP_009228089.1| hypothetical protein AYB38_gp59 (mitochondrion) [Brassica nigra] ref|YP_009320194.1| orf128 (mitochondrion) [Sinapis arvensis] gb|AGY62803.1| orf128 (mitochondrion) [Eruca vesicaria subsp. sativa] gb|AHY20338.1| NADH dehydrogenase subunit 1 (mitochondrion) (mitochondrion) [Brassica juncea var. tumida] gb|AJD85458.1| hypothetical protein BniMp019 (mitochondrion) [Brassica nigra] gb|AJR33083.1| orf128 (mitochondrion) [Sinapis arvensis] Length = 128 Score = 60.8 bits (146), Expect = 3e-09 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVSA 234 AEANVPGSRGLILTETRGGSLPT K +I GK KNV A Sbjct: 92 AEANVPGSRGLILTETRGGSLPTQKYSIFGKTKNVIA 128 >ref|XP_019266604.1| PREDICTED: uncharacterized protein LOC109244033 [Nicotiana attenuata] Length = 290 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPK 246 AEANVPGSRGLILTETRGGSLPT K +ILGKPK Sbjct: 59 AEANVPGSRGLILTETRGGSLPTSKYSILGKPK 91 >ref|XP_019261126.1| PREDICTED: uncharacterized protein LOC109239076 [Nicotiana attenuata] Length = 188 Score = 59.3 bits (142), Expect = 4e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNV 240 AEANVPGS GLILTETRGGSLPT K +ILGKPK V Sbjct: 106 AEANVPGSWGLILTETRGGSLPTSKYSILGKPKKV 140 >emb|CDY45510.1| BnaCnng12690D [Brassica napus] Length = 192 Score = 59.3 bits (142), Expect = 4e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNVS 237 AEANVPGSRGLILTETRGGSLPT K +I GK KN S Sbjct: 44 AEANVPGSRGLILTETRGGSLPTQKYSIFGKTKNSS 79 >ref|XP_024016261.1| uncharacterized protein LOC112089740 [Eutrema salsugineum] Length = 266 Score = 60.1 bits (144), Expect = 4e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPKNV 240 AEANVPGSRGLILTETRGGSLPT K +I GK KNV Sbjct: 136 AEANVPGSRGLILTETRGGSLPTQKYSIFGKTKNV 170 >gb|PHU11362.1| NADH-ubiquinone oxidoreductase chain 1 [Capsicum chinense] Length = 75 Score = 56.2 bits (134), Expect = 6e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGK 252 AEANVPGSRGLILTETRGGSLPT K +ILGK Sbjct: 44 AEANVPGSRGLILTETRGGSLPTSKYSILGK 74 >ref|YP_009306081.1| NADH dehydrogenase subunit 1 (mitochondrion) [Corchorus capsularis] gb|AOO95919.1| NADH dehydrogenase subunit 1 (mitochondrion) [Corchorus capsularis] Length = 287 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -2 Query: 326 GSRGLILTETRGGSLPT*KSAILGKPKNVSA*REPY*KGP 207 GSRGLILTETRGGSLPT K +IL KPK + PY GP Sbjct: 166 GSRGLILTETRGGSLPTEKYSILEKPKKATE-LHPYSPGP 204 Score = 34.3 bits (77), Expect(2) = 1e-07 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 361 LIVHCWRKPMSRG 323 LIVHCWRKPMSRG Sbjct: 154 LIVHCWRKPMSRG 166 >ref|YP_009381499.1| hypothetical protein AEK19_MT1086 (mitochondrion) [Utricularia reniformis] gb|ART30346.1| hypothetical protein AEK19_MT1086 (mitochondrion) [Utricularia reniformis] Length = 51 Score = 54.7 bits (130), Expect = 1e-07 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGK 252 AEANVPGSRGLILTETRGGSLPT K LGK Sbjct: 2 AEANVPGSRGLILTETRGGSLPTSKKIFLGK 32 >gb|PHT69462.1| NADH-ubiquinone oxidoreductase chain 1 [Capsicum annuum] Length = 321 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGKPK 246 AEANVPGSRGLILTETRGGSLPT K +ILGK K Sbjct: 106 AEANVPGSRGLILTETRGGSLPTSKYSILGKRK 138 >ref|XP_015159342.1| PREDICTED: NADH-ubiquinone oxidoreductase chain 1-like [Solanum tuberosum] Length = 137 Score = 54.7 bits (130), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 344 AEANVPGSRGLILTETRGGSLPT*KSAILGK 252 A+ANVPGSRGLILTETRGGSLPT K +ILGK Sbjct: 106 AKANVPGSRGLILTETRGGSLPTSKYSILGK 136