BLASTX nr result
ID: Chrysanthemum21_contig00042439
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00042439 (748 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022891237.1| uncharacterized protein LOC111406197 [Olea e... 54 1e-05 >ref|XP_022891237.1| uncharacterized protein LOC111406197 [Olea europaea var. sylvestris] Length = 103 Score = 53.5 bits (127), Expect = 1e-05 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 84 FGHLSLVRIVGFLLPCYIMVWTISTLQCRRQRQ 182 F LSL+R+ GFLLPCYIM+W IS LQ RRQRQ Sbjct: 28 FFSLSLLRVAGFLLPCYIMIWAISILQQRRQRQ 60