BLASTX nr result
ID: Chrysanthemum21_contig00042343
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00042343 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023772019.1| elongation of fatty acids protein 3-like [La... 89 1e-18 gb|KVI06581.1| GNS1/SUR4 membrane protein [Cynara cardunculus va... 85 3e-17 ref|XP_021983649.1| elongation of fatty acids protein 3-like [He... 82 4e-16 ref|XP_022018079.1| elongation of fatty acids protein 3-like [He... 69 3e-11 ref|XP_011085662.1| elongation of fatty acids protein 3-like [Se... 60 7e-08 ref|XP_019229106.1| PREDICTED: elongation of fatty acids protein... 55 3e-06 ref|XP_009799692.1| PREDICTED: elongation of fatty acids protein... 55 3e-06 ref|XP_009606347.1| PREDICTED: elongation of fatty acids protein... 55 3e-06 gb|PHT91709.1| Elongation of fatty acids protein 3-like [Capsicu... 52 7e-06 ref|XP_021900286.1| elongation of fatty acids protein 3-like [Ca... 54 8e-06 gb|KZV15092.1| hypothetical protein F511_34928 [Dorcoceras hygro... 54 8e-06 >ref|XP_023772019.1| elongation of fatty acids protein 3-like [Lactuca sativa] gb|PLY79163.1| hypothetical protein LSAT_4X121041 [Lactuca sativa] Length = 289 Score = 88.6 bits (218), Expect = 1e-18 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 14 CNGIGAWIINSILNGAFLFMFLNSFVKMRWIRRKAMESSTTTNGKME 154 CNGIGAW+ NSILNGAFLFMFLNSFVKMRWIRRKAMESS TNGK+E Sbjct: 244 CNGIGAWVFNSILNGAFLFMFLNSFVKMRWIRRKAMESS-ATNGKLE 289 >gb|KVI06581.1| GNS1/SUR4 membrane protein [Cynara cardunculus var. scolymus] Length = 287 Score = 85.1 bits (209), Expect = 3e-17 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +2 Query: 14 CNGIGAWIINSILNGAFLFMFLNSFVKMRWIRRKAMESSTTTNGKME 154 CNGIGAW+ NS+LNGAFLFMFLNSF+ MRWIRRKAME STTTN K+E Sbjct: 242 CNGIGAWVFNSVLNGAFLFMFLNSFITMRWIRRKAME-STTTNAKIE 287 >ref|XP_021983649.1| elongation of fatty acids protein 3-like [Helianthus annuus] gb|OTG16164.1| putative ELO family [Helianthus annuus] Length = 288 Score = 82.0 bits (201), Expect = 4e-16 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = +2 Query: 14 CNGIGAWIINSILNGAFLFMFLNSFVKMRWIRRKAMESSTTTNGKME 154 CNGIGAW+ NS++NGAFLFMFLNSFV+MRWIRRKA+E S +TNGK++ Sbjct: 243 CNGIGAWVFNSVINGAFLFMFLNSFVRMRWIRRKALE-SMSTNGKID 288 >ref|XP_022018079.1| elongation of fatty acids protein 3-like [Helianthus annuus] gb|OTF91183.1| putative ELO family [Helianthus annuus] Length = 291 Score = 68.9 bits (167), Expect = 3e-11 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +2 Query: 14 CNGIGAWIINSILNGAFLFMFLNSFVKMRWIRRKAMESSTTTNGKME 154 CNGIGAW+ NSILNGAFL MF SF+K R IRRKAME ST TN K + Sbjct: 246 CNGIGAWVFNSILNGAFLIMFFKSFIKRRRIRRKAME-STATNVKSD 291 >ref|XP_011085662.1| elongation of fatty acids protein 3-like [Sesamum indicum] Length = 302 Score = 59.7 bits (143), Expect = 7e-08 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 14 CNGIGAWIINSILNGAFLFMFLNSFVKMRWIRRKAMESSTTTNG 145 CNGIGAW+ NS+LNGA LF+FLN +V+M +RKA S+T G Sbjct: 241 CNGIGAWVFNSVLNGAILFLFLNFYVRMHLKKRKAGASATAAAG 284 >ref|XP_019229106.1| PREDICTED: elongation of fatty acids protein 3-like [Nicotiana attenuata] gb|OIT30299.1| elongation of fatty acids protein 3-like protein [Nicotiana attenuata] Length = 290 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +2 Query: 14 CNGIGAWIINSILNGAFLFMFLNSFVKMRWIRRK 115 CNGIGAW++NS+LNGA LF+FLN +VK+ +RK Sbjct: 239 CNGIGAWVLNSVLNGAILFLFLNFYVKLHLEKRK 272 >ref|XP_009799692.1| PREDICTED: elongation of fatty acids protein 3-like [Nicotiana sylvestris] ref|XP_016486438.1| PREDICTED: elongation of fatty acids protein 3-like [Nicotiana tabacum] Length = 290 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +2 Query: 14 CNGIGAWIINSILNGAFLFMFLNSFVKMRWIRRK 115 CNGIGAW++NS+LNGA LF+FLN +VK+ +RK Sbjct: 239 CNGIGAWVLNSVLNGAILFLFLNFYVKLHLEKRK 272 >ref|XP_009606347.1| PREDICTED: elongation of fatty acids protein 3-like [Nicotiana tomentosiformis] ref|XP_016446806.1| PREDICTED: elongation of fatty acids protein 3-like [Nicotiana tabacum] Length = 290 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +2 Query: 14 CNGIGAWIINSILNGAFLFMFLNSFVKMRWIRRK 115 CNGIGAW++NS+LNGA LF+FLN +VK+ +RK Sbjct: 239 CNGIGAWVLNSVLNGAILFLFLNFYVKLHLEKRK 272 >gb|PHT91709.1| Elongation of fatty acids protein 3-like [Capsicum annuum] Length = 122 Score = 52.0 bits (123), Expect = 7e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 14 CNGIGAWIINSILNGAFLFMFLNSFVKMRWIRRKAMES 127 CNGIGAW+ NS+LN A LF+FLN +VK+ RK E+ Sbjct: 74 CNGIGAWVFNSVLNAAILFLFLNFYVKVHLRSRKVEET 111 >ref|XP_021900286.1| elongation of fatty acids protein 3-like [Carica papaya] Length = 289 Score = 53.9 bits (128), Expect = 8e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = +2 Query: 14 CNGIGAWIINSILNGAFLFMFLNSFVKMRWIRRKAMESSTTTN 142 CNGIGAW+ NS+LNGA L +FLN +VKM +R+K + S N Sbjct: 242 CNGIGAWVFNSVLNGAILLLFLNFYVKMH-LRKKMKKDSGVVN 283 >gb|KZV15092.1| hypothetical protein F511_34928 [Dorcoceras hygrometricum] Length = 298 Score = 53.9 bits (128), Expect = 8e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +2 Query: 14 CNGIGAWIINSILNGAFLFMFLNSFVKMRWIRRK 115 CNGIGAWI NS+LNGA LF+FLN +VKM+ RK Sbjct: 241 CNGIGAWIFNSVLNGAILFLFLNFYVKMQSGGRK 274