BLASTX nr result
ID: Chrysanthemum21_contig00042264
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00042264 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002957574.1| hypothetical protein VOLCADRAFT_84159 [Volvo... 54 1e-05 >ref|XP_002957574.1| hypothetical protein VOLCADRAFT_84159 [Volvox carteri f. nagariensis] gb|EFJ41344.1| hypothetical protein VOLCADRAFT_84159 [Volvox carteri f. nagariensis] Length = 542 Score = 53.9 bits (128), Expect = 1e-05 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +3 Query: 216 QLNAAWALTSITWGTSEHAKLDIDNLAVPTLVELLRSPGACVRE 347 Q AAWALT++ GTSEH K+ ID+ AVP VELL SP VRE Sbjct: 134 QFEAAWALTNVASGTSEHTKVVIDHNAVPIFVELLNSPNDDVRE 177