BLASTX nr result
ID: Chrysanthemum21_contig00041952
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00041952 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003611792.2| MAP kinase kinase kinase [Medicago truncatul... 52 3e-06 >ref|XP_003611792.2| MAP kinase kinase kinase [Medicago truncatula] gb|AES94750.2| MAP kinase kinase kinase [Medicago truncatula] Length = 697 Score = 51.6 bits (122), Expect(2) = 3e-06 Identities = 24/52 (46%), Positives = 33/52 (63%) Frame = +3 Query: 135 SLDGKNFVCFFFVRNPAERPVSTMLFTHRFFNYLTHQDI*DSTKIIKGMTLL 290 S +GK+F+ FVRNPAERP ++ML HRF + H D S+ + G TL+ Sbjct: 603 STEGKDFLRLCFVRNPAERPTASMLLEHRFLKNVQHSDPSPSSHLYNGTTLM 654 Score = 26.9 bits (58), Expect(2) = 3e-06 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 83 AEMFKVMKQTKVMPETRVTRWQKF 154 A MFKVMK T +PET T + F Sbjct: 586 AAMFKVMKDTPPIPETLSTEGKDF 609