BLASTX nr result
ID: Chrysanthemum21_contig00041943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00041943 (625 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY09553.1| Uncharacterized protein TCM_024961 [Theobroma cacao] 52 7e-06 >gb|EOY09553.1| Uncharacterized protein TCM_024961 [Theobroma cacao] Length = 65 Score = 52.4 bits (124), Expect = 7e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +1 Query: 502 LPVGT*IKDSKLDGFNFFAWSKTVRIYLRSIGKASHFKDDP 624 +PV T I + KLDG N+ WSKTVR+YLRSI K H +DP Sbjct: 17 IPVMTKITEHKLDGSNYLDWSKTVRLYLRSIDKDDHITNDP 57