BLASTX nr result
ID: Chrysanthemum21_contig00041637
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00041637 (725 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY92280.1| hypothetical protein LSAT_2X130361 [Lactuca sativa] 58 1e-07 >gb|PLY92280.1| hypothetical protein LSAT_2X130361 [Lactuca sativa] Length = 179 Score = 57.8 bits (138), Expect(2) = 1e-07 Identities = 24/56 (42%), Positives = 37/56 (66%) Frame = -1 Query: 278 SMIWSNILPQKVNTFMWRMTLDRLSYCLNLSTRGMEIQQICCPS*KGIVESNQHIF 111 S W+ +P K+N FMWR+ L+R++ +NLS RG++I + CPS VE + H+F Sbjct: 13 STCWNKYVPIKINVFMWRVLLNRITTRINLSNRGIDIPCLFCPSCDNAVEDSNHVF 68 Score = 26.6 bits (57), Expect(2) = 1e-07 Identities = 9/39 (23%), Positives = 17/39 (43%) Frame = -2 Query: 121 NTFFECETAQNIWRLVLMWCDLNMASFKSNNALKDWLSS 5 + F C+ A +W + W DL + + L W+ + Sbjct: 66 HVFLLCDIAVQVWNAITRWVDLTLRPLINIVELMSWVDT 104