BLASTX nr result
ID: Chrysanthemum21_contig00041606
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00041606 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH89839.1| Coactivator CBP, KIX domain-containing protein [C... 69 4e-11 gb|ALT31528.1| mediator of RNA polymerase II transcription subun... 60 8e-08 ref|XP_017225453.1| PREDICTED: mediator of RNA polymerase II tra... 58 4e-07 gb|KZN11174.1| hypothetical protein DCAR_003830 [Daucus carota s... 58 4e-07 gb|KDO52332.1| hypothetical protein CISIN_1g000769mg [Citrus sin... 57 5e-07 gb|KDO52329.1| hypothetical protein CISIN_1g000769mg [Citrus sin... 57 5e-07 gb|KDO52330.1| hypothetical protein CISIN_1g000769mg [Citrus sin... 57 5e-07 ref|XP_024036137.1| mediator of RNA polymerase II transcription ... 57 5e-07 gb|KDO52331.1| hypothetical protein CISIN_1g000769mg [Citrus sin... 57 5e-07 ref|XP_024036136.1| mediator of RNA polymerase II transcription ... 57 5e-07 gb|ESR40737.1| hypothetical protein CICLE_v10024717mg [Citrus cl... 57 5e-07 ref|XP_024036135.1| mediator of RNA polymerase II transcription ... 57 5e-07 ref|XP_006427496.1| mediator of RNA polymerase II transcription ... 57 5e-07 ref|XP_024036133.1| mediator of RNA polymerase II transcription ... 57 5e-07 gb|AAN62354.1|AF506028_23 CTV.22 [Citrus trifoliata] 57 5e-07 ref|XP_019265051.1| PREDICTED: mediator of RNA polymerase II tra... 57 9e-07 ref|XP_016448923.1| PREDICTED: mediator of RNA polymerase II tra... 56 1e-06 ref|XP_018629889.1| PREDICTED: mediator of RNA polymerase II tra... 56 1e-06 ref|XP_016448921.1| PREDICTED: mediator of RNA polymerase II tra... 56 1e-06 ref|XP_009613838.1| PREDICTED: mediator of RNA polymerase II tra... 56 1e-06 >gb|KVH89839.1| Coactivator CBP, KIX domain-containing protein [Cynara cardunculus var. scolymus] Length = 1190 Score = 68.9 bits (167), Expect = 4e-11 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPSTLSTYHMQGDSGKADSRAPLRSN 341 PQI+Q ++L S+TKSGTP QS NSPFIVSSPST ST HM G+S K +S SN Sbjct: 848 PQIDQQNLLNSLTKSGTPLQSANSPFIVSSPSTTSTSHMPGESEKVNSGVSSLSN 902 >gb|ALT31528.1| mediator of RNA polymerase II transcription subunit 15-like protein, partial [Rehmannia glutinosa] Length = 1012 Score = 59.7 bits (143), Expect = 8e-08 Identities = 33/56 (58%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQI+Q ++LAS TK GTP QS NSPFIV SPST ++ M GDS K +S P SN Sbjct: 612 PQIDQQNLLASHTKGGTPLQSANSPFIVPSPSTSMAPSPMPGDSEKMNSGVPSLSN 667 >ref|XP_017225453.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a [Daucus carota subsp. sativus] ref|XP_017225459.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a [Daucus carota subsp. sativus] Length = 1363 Score = 57.8 bits (138), Expect = 4e-07 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPSTLST-YHMQGDSGKADSRAPLRSN 341 PQI+Q +ML+++TK+GTP QSVNSPFIV SPST S M G+S K +S SN Sbjct: 961 PQIDQQNMLSALTKNGTPLQSVNSPFIVPSPSTPSVPSPMPGESEKVNSGVSTLSN 1016 >gb|KZN11174.1| hypothetical protein DCAR_003830 [Daucus carota subsp. sativus] Length = 1405 Score = 57.8 bits (138), Expect = 4e-07 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPSTLST-YHMQGDSGKADSRAPLRSN 341 PQI+Q +ML+++TK+GTP QSVNSPFIV SPST S M G+S K +S SN Sbjct: 1003 PQIDQQNMLSALTKNGTPLQSVNSPFIVPSPSTPSVPSPMPGESEKVNSGVSTLSN 1058 >gb|KDO52332.1| hypothetical protein CISIN_1g000769mg [Citrus sinensis] Length = 1197 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQ++Q ++L S+TKSGTP QSVNSPF+V SPST ++ M GDS K S SN Sbjct: 864 PQVDQQNLLQSITKSGTPLQSVNSPFVVPSPSTPMAPSPMPGDSEKPISGISSLSN 919 >gb|KDO52329.1| hypothetical protein CISIN_1g000769mg [Citrus sinensis] Length = 1251 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQ++Q ++L S+TKSGTP QSVNSPF+V SPST ++ M GDS K S SN Sbjct: 864 PQVDQQNLLQSITKSGTPLQSVNSPFVVPSPSTPMAPSPMPGDSEKPISGISSLSN 919 >gb|KDO52330.1| hypothetical protein CISIN_1g000769mg [Citrus sinensis] Length = 1265 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQ++Q ++L S+TKSGTP QSVNSPF+V SPST ++ M GDS K S SN Sbjct: 864 PQVDQQNLLQSITKSGTPLQSVNSPFVVPSPSTPMAPSPMPGDSEKPISGISSLSN 919 >ref|XP_024036137.1| mediator of RNA polymerase II transcription subunit 15a isoform X5 [Citrus clementina] Length = 1266 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQ++Q ++L S+TKSGTP QSVNSPF+V SPST ++ M GDS K S SN Sbjct: 865 PQVDQQNLLQSITKSGTPLQSVNSPFVVPSPSTPMAPSPMPGDSEKPISGISSLSN 920 >gb|KDO52331.1| hypothetical protein CISIN_1g000769mg [Citrus sinensis] Length = 1294 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQ++Q ++L S+TKSGTP QSVNSPF+V SPST ++ M GDS K S SN Sbjct: 864 PQVDQQNLLQSITKSGTPLQSVNSPFVVPSPSTPMAPSPMPGDSEKPISGISSLSN 919 >ref|XP_024036136.1| mediator of RNA polymerase II transcription subunit 15a isoform X4 [Citrus clementina] Length = 1345 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQ++Q ++L S+TKSGTP QSVNSPF+V SPST ++ M GDS K S SN Sbjct: 944 PQVDQQNLLQSITKSGTPLQSVNSPFVVPSPSTPMAPSPMPGDSEKPISGISSLSN 999 >gb|ESR40737.1| hypothetical protein CICLE_v10024717mg [Citrus clementina] Length = 1369 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQ++Q ++L S+TKSGTP QSVNSPF+V SPST ++ M GDS K S SN Sbjct: 982 PQVDQQNLLQSITKSGTPLQSVNSPFVVPSPSTPMAPSPMPGDSEKPISGISSLSN 1037 >ref|XP_024036135.1| mediator of RNA polymerase II transcription subunit 15a isoform X3 [Citrus clementina] Length = 1378 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQ++Q ++L S+TKSGTP QSVNSPF+V SPST ++ M GDS K S SN Sbjct: 991 PQVDQQNLLQSITKSGTPLQSVNSPFVVPSPSTPMAPSPMPGDSEKPISGISSLSN 1046 >ref|XP_006427496.1| mediator of RNA polymerase II transcription subunit 15a isoform X2 [Citrus clementina] ref|XP_024036134.1| mediator of RNA polymerase II transcription subunit 15a isoform X2 [Citrus clementina] gb|ESR40736.1| hypothetical protein CICLE_v10024717mg [Citrus clementina] Length = 1383 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQ++Q ++L S+TKSGTP QSVNSPF+V SPST ++ M GDS K S SN Sbjct: 982 PQVDQQNLLQSITKSGTPLQSVNSPFVVPSPSTPMAPSPMPGDSEKPISGISSLSN 1037 >ref|XP_024036133.1| mediator of RNA polymerase II transcription subunit 15a isoform X1 [Citrus clementina] Length = 1392 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQ++Q ++L S+TKSGTP QSVNSPF+V SPST ++ M GDS K S SN Sbjct: 991 PQVDQQNLLQSITKSGTPLQSVNSPFVVPSPSTPMAPSPMPGDSEKPISGISSLSN 1046 >gb|AAN62354.1|AF506028_23 CTV.22 [Citrus trifoliata] Length = 1405 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 177 PQINQHSMLASVTKSGTPSQSVNSPFIVSSPST-LSTYHMQGDSGKADSRAPLRSN 341 PQ++Q ++L S+TKSGTP QSVNSPF+V SPST ++ M GDS K S SN Sbjct: 1004 PQVDQQNLLQSITKSGTPLQSVNSPFVVPSPSTPMAPSPMPGDSEKPISGISSLSN 1059 >ref|XP_019265051.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like [Nicotiana attenuata] gb|OIT35983.1| mediator of rna polymerase ii transcription subunit 15a [Nicotiana attenuata] Length = 965 Score = 56.6 bits (135), Expect = 9e-07 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 9/81 (11%) Frame = +3 Query: 105 LKVSFCEKHKN*TNIATVDSNSFFPQINQH--------SMLASVTKSGTPSQSVNSPFIV 260 LKV + N+ + NSF PQ+ QH +MLAS+TK+G P QS NSPF+V Sbjct: 539 LKVQSSMEAMQQNNLTKLQHNSFSPQVTQHPSPQTDEQNMLASLTKAGPPLQSANSPFVV 598 Query: 261 SSPST-LSTYHMQGDSGKADS 320 SPST M GDS K + Sbjct: 599 PSPSTSWDLSPMPGDSEKVST 619 >ref|XP_016448923.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X3 [Nicotiana tabacum] Length = 679 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 9/81 (11%) Frame = +3 Query: 105 LKVSFCEKHKN*TNIATVDSNSFFPQINQH--------SMLASVTKSGTPSQSVNSPFIV 260 LKV + N+ + NSF PQ+ QH +MLAS+TK+G P QS NSPF+V Sbjct: 544 LKVQSSMEAMQQNNLTKLQHNSFSPQVTQHPSPQTDEQNMLASLTKAGPPLQSANSPFVV 603 Query: 261 SSPST-LSTYHMQGDSGKADS 320 SPST M GDS K + Sbjct: 604 PSPSTSWDLSPMPGDSVKVST 624 >ref|XP_018629889.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X3 [Nicotiana tomentosiformis] Length = 782 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 9/81 (11%) Frame = +3 Query: 105 LKVSFCEKHKN*TNIATVDSNSFFPQINQH--------SMLASVTKSGTPSQSVNSPFIV 260 LKV + N+ + NSF PQ+ QH +MLAS+TK+G P QS NSPF+V Sbjct: 519 LKVQSSMEAMQQNNLTKLQHNSFSPQVTQHPSPQTDEQNMLASLTKAGPPLQSANSPFVV 578 Query: 261 SSPST-LSTYHMQGDSGKADS 320 SPST M GDS K + Sbjct: 579 PSPSTSWDLSPMPGDSVKVST 599 >ref|XP_016448921.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X1 [Nicotiana tabacum] Length = 805 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 9/81 (11%) Frame = +3 Query: 105 LKVSFCEKHKN*TNIATVDSNSFFPQINQH--------SMLASVTKSGTPSQSVNSPFIV 260 LKV + N+ + NSF PQ+ QH +MLAS+TK+G P QS NSPF+V Sbjct: 544 LKVQSSMEAMQQNNLTKLQHNSFSPQVTQHPSPQTDEQNMLASLTKAGPPLQSANSPFVV 603 Query: 261 SSPST-LSTYHMQGDSGKADS 320 SPST M GDS K + Sbjct: 604 PSPSTSWDLSPMPGDSVKVST 624 >ref|XP_009613838.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X1 [Nicotiana tomentosiformis] Length = 942 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 9/81 (11%) Frame = +3 Query: 105 LKVSFCEKHKN*TNIATVDSNSFFPQINQH--------SMLASVTKSGTPSQSVNSPFIV 260 LKV + N+ + NSF PQ+ QH +MLAS+TK+G P QS NSPF+V Sbjct: 519 LKVQSSMEAMQQNNLTKLQHNSFSPQVTQHPSPQTDEQNMLASLTKAGPPLQSANSPFVV 578 Query: 261 SSPST-LSTYHMQGDSGKADS 320 SPST M GDS K + Sbjct: 579 PSPSTSWDLSPMPGDSVKVST 599