BLASTX nr result
ID: Chrysanthemum21_contig00041580
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00041580 (498 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY80414.1| hypothetical protein LSAT_8X112340 [Lactuca sativa] 69 2e-11 >gb|PLY80414.1| hypothetical protein LSAT_8X112340 [Lactuca sativa] Length = 157 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +1 Query: 355 ASSGNPLTPSKRQVQCPICKRNMYHEKALCGHIRWHTQDERDANSAEI 498 ++ G L ++R V CPICK++MYHEKALCGHIRWHTQ+ER A S +I Sbjct: 73 SADGILLGTARRPVICPICKKDMYHEKALCGHIRWHTQEERLAASRDI 120