BLASTX nr result
ID: Chrysanthemum21_contig00041534
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00041534 (540 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023735335.1| hydroxyacylglutathione hydrolase 2, mitochon... 59 8e-07 >ref|XP_023735335.1| hydroxyacylglutathione hydrolase 2, mitochondrial-like isoform X1 [Lactuca sativa] Length = 353 Score = 58.5 bits (140), Expect = 8e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 433 ELSELGNMNIEENVGEKQARKMVCVWPGIRQLCLRK 540 E + LG M +++NV EK+AR+MVCVWPGIRQLCLRK Sbjct: 26 ESTNLGTMPLQDNVWEKKARRMVCVWPGIRQLCLRK 61