BLASTX nr result
ID: Chrysanthemum21_contig00041374
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00041374 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022009615.1| outer envelope pore protein 24, chloroplasti... 60 2e-08 ref|XP_023754535.1| outer envelope pore protein 24B, chloroplast... 58 2e-07 gb|KVI08827.1| hypothetical protein Ccrd_012787 [Cynara carduncu... 56 7e-07 >ref|XP_022009615.1| outer envelope pore protein 24, chloroplastic-like [Helianthus annuus] gb|OTF97958.1| hypothetical protein HannXRQ_Chr14g0440381 [Helianthus annuus] Length = 212 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 170 VEPRYDFGDNSWDLAVSRRISDDSVVRGLYQPST 69 VEP YDFGDNSWDLAVSRR+ D SVVRG YQ ST Sbjct: 135 VEPSYDFGDNSWDLAVSRRLYDGSVVRGSYQSST 168 >ref|XP_023754535.1| outer envelope pore protein 24B, chloroplastic-like [Lactuca sativa] gb|PLY92489.1| hypothetical protein LSAT_2X76680 [Lactuca sativa] Length = 212 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 179 VLPVEPRYDFGDNSWDLAVSRRISDDSVVRGLYQPST 69 V +EP YDF +NSWDLAVSRR+ DDSVVR YQ ST Sbjct: 132 VTTIEPCYDFAENSWDLAVSRRVDDDSVVRASYQSST 168 >gb|KVI08827.1| hypothetical protein Ccrd_012787 [Cynara cardunculus var. scolymus] Length = 213 Score = 56.2 bits (134), Expect = 7e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 179 VLPVEPRYDFGDNSWDLAVSRRISDDSVVRGLYQPST 69 V+ +EP YDF +NSWDLAVSRRI D SVVRG Y ST Sbjct: 133 VMTIEPCYDFAENSWDLAVSRRIYDGSVVRGSYHSST 169