BLASTX nr result
ID: Chrysanthemum21_contig00041173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00041173 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI10404.1| Armadillo [Cynara cardunculus var. scolymus] 73 3e-12 ref|XP_021991312.1| uncharacterized protein LOC110888079 [Helian... 68 1e-10 ref|XP_024021940.1| U-box domain-containing protein 4 [Morus not... 62 1e-08 gb|EXB67421.1| U-box domain-containing protein 4 [Morus notabilis] 62 2e-08 ref|XP_015902612.1| PREDICTED: vacuolar protein 8 [Ziziphus jujuba] 60 7e-08 gb|PON94100.1| Armadillo-type fold containing protein [Trema ori... 57 1e-06 ref|XP_023894287.1| armadillo repeat-containing protein 3 [Querc... 57 1e-06 ref|XP_002533042.1| PREDICTED: U-box domain-containing protein 1... 55 5e-06 ref|XP_021680938.1| armadillo repeat-containing protein 4 [Hevea... 55 5e-06 >gb|KVI10404.1| Armadillo [Cynara cardunculus var. scolymus] Length = 469 Score = 72.8 bits (177), Expect = 3e-12 Identities = 39/66 (59%), Positives = 52/66 (78%), Gaps = 1/66 (1%) Frame = -3 Query: 195 MDESSSKGSLI-ECSDWVLALDNFEHVIATGNEPLQLQAISKLSHLCNRAPESVLISTIP 19 MD+S S+G+ E ++W LAL +FE++IATG++ LQ+QAI KLS L NRAPE +LI T+P Sbjct: 1 MDQSLSEGTQTQENTNWELALHHFENLIATGSDALQVQAIIKLSRLSNRAPERILICTVP 60 Query: 18 ILVELL 1 ILVE L Sbjct: 61 ILVEHL 66 >ref|XP_021991312.1| uncharacterized protein LOC110888079 [Helianthus annuus] gb|OTG07749.1| putative ARM repeat superfamily protein [Helianthus annuus] Length = 462 Score = 68.2 bits (165), Expect = 1e-10 Identities = 31/54 (57%), Positives = 42/54 (77%) Frame = -3 Query: 162 ECSDWVLALDNFEHVIATGNEPLQLQAISKLSHLCNRAPESVLISTIPILVELL 1 + DWV +L FEH+IAT +E LQ+++I KLS L NR P S+L+ST+PILV+LL Sbjct: 5 QSQDWVQSLHQFEHIIATNSESLQVESIIKLSRLSNRIPVSILVSTVPILVDLL 58 >ref|XP_024021940.1| U-box domain-containing protein 4 [Morus notabilis] ref|XP_024021941.1| U-box domain-containing protein 4 [Morus notabilis] ref|XP_024021942.1| U-box domain-containing protein 4 [Morus notabilis] Length = 465 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -3 Query: 153 DWVLALDNFEHVIATGNEPLQLQAISKLSHLCNRAPESVLISTIPILVELL 1 DW A + FE V+++G E L+L+AI+KL+H RAP++VL+STIPIL LL Sbjct: 16 DWEQAFNQFESVVSSGTEALRLEAITKLTHFSKRAPQNVLVSTIPILARLL 66 >gb|EXB67421.1| U-box domain-containing protein 4 [Morus notabilis] Length = 680 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -3 Query: 153 DWVLALDNFEHVIATGNEPLQLQAISKLSHLCNRAPESVLISTIPILVELL 1 DW A + FE V+++G E L+L+AI+KL+H RAP++VL+STIPIL LL Sbjct: 16 DWEQAFNQFESVVSSGTEALRLEAITKLTHFSKRAPQNVLVSTIPILARLL 66 >ref|XP_015902612.1| PREDICTED: vacuolar protein 8 [Ziziphus jujuba] Length = 469 Score = 60.5 bits (145), Expect = 7e-08 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = -3 Query: 153 DWVLALDNFEHVIATGNEPLQLQAISKLSHLCNRAPESVLISTIPILVELL 1 DW A D FE VIA+G+E ++LQ +L+ LC RAPE VL+ TIPIL LL Sbjct: 16 DWEQAFDRFESVIASGSEAMRLQVTKRLAALCKRAPEHVLVLTIPILAGLL 66 >gb|PON94100.1| Armadillo-type fold containing protein [Trema orientalis] Length = 435 Score = 57.0 bits (136), Expect = 1e-06 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = -3 Query: 153 DWVLALDNFEHVIATGNEPLQLQAISKLSHLCNRAPESVLISTIPILVELL 1 DW A + FE VIA+G E +L+ I+KL+HL RAPE VL +IPIL LL Sbjct: 16 DWEQAFNRFESVIASGTEATRLEVIAKLAHLSKRAPEYVLARSIPILARLL 66 >ref|XP_023894287.1| armadillo repeat-containing protein 3 [Quercus suber] ref|XP_023894293.1| armadillo repeat-containing protein 3 [Quercus suber] Length = 469 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/51 (47%), Positives = 37/51 (72%) Frame = -3 Query: 153 DWVLALDNFEHVIATGNEPLQLQAISKLSHLCNRAPESVLISTIPILVELL 1 DW A + +E+VI++G E ++++A KL+H C AP+S+L TIPIL E+L Sbjct: 16 DWEKAFNKYENVISSGTEAMRIKATVKLAHFCKYAPQSILARTIPILAEIL 66 >ref|XP_002533042.1| PREDICTED: U-box domain-containing protein 13 [Ricinus communis] gb|EEF29350.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 468 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/55 (47%), Positives = 38/55 (69%) Frame = -3 Query: 165 IECSDWVLALDNFEHVIATGNEPLQLQAISKLSHLCNRAPESVLISTIPILVELL 1 I C DW AL ++ +V+++G E LQ++A KL+HL AP+ VL T+PIL +LL Sbjct: 9 ITCPDWEKALCSYHNVLSSGIESLQVKATIKLAHLSKYAPDDVLTRTVPILTKLL 63 >ref|XP_021680938.1| armadillo repeat-containing protein 4 [Hevea brasiliensis] Length = 469 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -3 Query: 156 SDWVLALDNFEHVIATGNEPLQLQAISKLSHLCNRAPESVLISTIPILVELL 1 +DW A +E VIA+G+E +Q++A +L+HL APE VL TIPIL +LL Sbjct: 15 TDWEEAFSRYESVIASGSESMQVKATIRLAHLSKHAPEHVLAGTIPILAKLL 66