BLASTX nr result
ID: Chrysanthemum21_contig00041167
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00041167 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023734468.1| chaperone protein dnaJ 16-like [Lactuca sati... 54 8e-06 >ref|XP_023734468.1| chaperone protein dnaJ 16-like [Lactuca sativa] gb|PLY73280.1| hypothetical protein LSAT_8X160460 [Lactuca sativa] Length = 401 Score = 54.3 bits (129), Expect = 8e-06 Identities = 30/58 (51%), Positives = 41/58 (70%), Gaps = 9/58 (15%) Frame = -2 Query: 284 IDDLLKERNEIQL---------RHINNKSMKRVVLKDNKHSSLKDITTKKKWFNIQVK 138 ID+LLK+RNEI R+ +++S K+VVLKD K +S+KD +KKKW+NIQVK Sbjct: 338 IDELLKQRNEIHASYTVTSQTKRNSSSRSKKKVVLKDEKKASIKD-GSKKKWYNIQVK 394