BLASTX nr result
ID: Chrysanthemum21_contig00041080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00041080 (477 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG17957.1| putative uncharacterized domain XH, Zinc finger-X... 62 5e-08 ref|XP_021976860.1| factor of DNA methylation 1-like [Helianthus... 62 5e-08 ref|XP_023761771.1| factor of DNA methylation 1-like [Lactuca sa... 60 1e-07 >gb|OTG17957.1| putative uncharacterized domain XH, Zinc finger-XS domain protein [Helianthus annuus] Length = 637 Score = 61.6 bits (148), Expect = 5e-08 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +2 Query: 344 DDQRQTAQALVRFNSDWICFNDACAFEKAFATAHHSKTEWSASE 475 DD Q+AQ LVRFN+DWI F +A FEK F +HHSK EWS +E Sbjct: 237 DDANQSAQVLVRFNNDWIGFKNAMVFEKYFEASHHSKKEWSDAE 280 >ref|XP_021976860.1| factor of DNA methylation 1-like [Helianthus annuus] ref|XP_021976861.1| factor of DNA methylation 1-like [Helianthus annuus] ref|XP_021976862.1| factor of DNA methylation 1-like [Helianthus annuus] Length = 639 Score = 61.6 bits (148), Expect = 5e-08 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +2 Query: 344 DDQRQTAQALVRFNSDWICFNDACAFEKAFATAHHSKTEWSASE 475 DD Q+AQ LVRFN+DWI F +A FEK F +HHSK EWS +E Sbjct: 163 DDANQSAQVLVRFNNDWIGFKNAMVFEKYFEASHHSKKEWSDAE 206 >ref|XP_023761771.1| factor of DNA methylation 1-like [Lactuca sativa] ref|XP_023761778.1| factor of DNA methylation 1-like [Lactuca sativa] gb|PLY98613.1| hypothetical protein LSAT_1X32080 [Lactuca sativa] Length = 634 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 344 DDQRQTAQALVRFNSDWICFNDACAFEKAFATAHHSKTEWSASE 475 D+++ TAQALVRFN+DW F +A FEK+F HHSK EW AS+ Sbjct: 162 DEEKTTAQALVRFNNDWTGFKNAMEFEKSFEANHHSKREWVASD 205