BLASTX nr result
ID: Chrysanthemum21_contig00041023
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00041023 (577 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023763874.1| uncharacterized protein LOC111912373 [Lactuc... 57 3e-06 >ref|XP_023763874.1| uncharacterized protein LOC111912373 [Lactuca sativa] Length = 408 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/59 (44%), Positives = 42/59 (71%) Frame = -2 Query: 228 YTACFEEITTYAEHQVATEGRRMEWFIRGLKTNIRELVSTRNLSTFQEAIGAAQEVEKK 52 YT F E + EHQ+ TE ++++ ++ GL+ NIRE VS R+L+TF++ + AA+E EK+ Sbjct: 223 YTYKFMEKARFVEHQIPTEKKKIKRYVWGLRANIREFVSNRDLATFRQVVEAAKEREKE 281