BLASTX nr result
ID: Chrysanthemum21_contig00040949
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00040949 (532 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU26428.1| hypothetical protein TSUD_293930 [Trifolium subt... 57 4e-06 dbj|GAU43457.1| hypothetical protein TSUD_140950 [Trifolium subt... 56 8e-06 >dbj|GAU26428.1| hypothetical protein TSUD_293930 [Trifolium subterraneum] Length = 1388 Score = 56.6 bits (135), Expect = 4e-06 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 4/75 (5%) Frame = +3 Query: 60 PEAILNSR----DTNKGKQLLVRWSNRPMEESTWEYESELRSVFPDFTDIGDNVNCQGEG 227 PEA+L +R +GKQ+L+ W R +EE+TWE E +RS FP F +GD VN + +G Sbjct: 1290 PEAVLAARRVKHQQEEGKQVLIYWKGRNVEEATWEDEMMIRSQFPKFA-LGDKVNLEEDG 1348 Query: 228 AVTTHNSGPNSLPVQ 272 + + N LP Q Sbjct: 1349 IDRSQPNEENILPNQ 1363 >dbj|GAU43457.1| hypothetical protein TSUD_140950 [Trifolium subterraneum] Length = 1378 Score = 55.8 bits (133), Expect = 8e-06 Identities = 32/93 (34%), Positives = 50/93 (53%), Gaps = 4/93 (4%) Frame = +3 Query: 60 PEAILNSRDTNKG-KQLLVRWSNRPMEESTWEYESELRSVFPDFTDIGDNVNCQGEGAVT 236 P AI N R + +G K++LV W + P+ E+TW S ++ FP+ ++ DN+ VT Sbjct: 1287 PSAIRNHRISVEGLKEILVEWKDLPLSEATWVTASTFKNQFPNL-NLEDNILFDAVDNVT 1345 Query: 237 THNSGPNSLPVQSRV---DRPKRNIKQPARLKD 326 N G S + +PKRNI++P R +D Sbjct: 1346 QQNRGSKEKDAASNIGPSHKPKRNIRRPKRYED 1378