BLASTX nr result
ID: Chrysanthemum21_contig00040494
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00040494 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023747196.1| heavy metal-associated isoprenylated plant p... 73 2e-12 gb|KVH98980.1| hypothetical protein Ccrd_022767 [Cynara carduncu... 68 6e-11 gb|KVI06197.1| Heavy metal-associated domain, HMA [Cynara cardun... 69 7e-11 ref|XP_019463445.1| PREDICTED: heavy metal-associated isoprenyla... 68 8e-11 gb|OMO84155.1| hypothetical protein CCACVL1_10970 [Corchorus cap... 67 2e-10 gb|OMP08365.1| hypothetical protein COLO4_06546 [Corchorus olito... 67 2e-10 gb|OTG16623.1| putative heavy metal-associated domain, HMA [Heli... 66 3e-10 gb|KJB07099.1| hypothetical protein B456_001G057100 [Gossypium r... 66 5e-10 gb|PPR87831.1| hypothetical protein GOBAR_AA32860 [Gossypium bar... 66 5e-10 ref|XP_012467708.1| PREDICTED: neurofilament medium polypeptide ... 66 6e-10 ref|XP_016744404.1| PREDICTED: heavy metal-associated isoprenyla... 66 6e-10 ref|XP_021633849.1| heavy metal-associated isoprenylated plant p... 66 6e-10 ref|XP_021633848.1| heavy metal-associated isoprenylated plant p... 66 6e-10 gb|ONI07940.1| hypothetical protein PRUPE_5G148500 [Prunus persica] 65 7e-10 ref|XP_023894485.1| heavy metal-associated isoprenylated plant p... 65 7e-10 ref|XP_021818294.1| heavy metal-associated isoprenylated plant p... 65 7e-10 ref|XP_020420193.1| heavy metal-associated isoprenylated plant p... 65 7e-10 ref|XP_017974007.1| PREDICTED: heavy metal-associated isoprenyla... 65 7e-10 ref|XP_008239502.1| PREDICTED: heavy metal-associated isoprenyla... 65 8e-10 ref|XP_017974006.1| PREDICTED: heavy metal-associated isoprenyla... 65 8e-10 >ref|XP_023747196.1| heavy metal-associated isoprenylated plant protein 7-like [Lactuca sativa] gb|PLY63645.1| hypothetical protein LSAT_4X81740 [Lactuca sativa] Length = 342 Score = 72.8 bits (177), Expect = 2e-12 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VES EPDLK+S+VSVKGTFTAP LV+YIHKRTGK AVIVKQ Sbjct: 170 VESVEPDLKSSQVSVKGTFTAPQLVEYIHKRTGKHAVIVKQ 210 >gb|KVH98980.1| hypothetical protein Ccrd_022767 [Cynara cardunculus var. scolymus] Length = 279 Score = 68.2 bits (165), Expect = 6e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESA PDLK+S+V+VKGTF A LVDY+HKRTGKQAVIVKQ Sbjct: 140 VESAVPDLKSSQVAVKGTFPATELVDYVHKRTGKQAVIVKQ 180 >gb|KVI06197.1| Heavy metal-associated domain, HMA [Cynara cardunculus var. scolymus] Length = 397 Score = 68.6 bits (166), Expect = 7e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK S+VSVKGTF A LVDY+HKRTGK+AVI+KQ Sbjct: 222 VESAEPDLKQSQVSVKGTFEAAQLVDYVHKRTGKRAVILKQ 262 >ref|XP_019463445.1| PREDICTED: heavy metal-associated isoprenylated plant protein 7-like [Lupinus angustifolius] gb|OIW17775.1| hypothetical protein TanjilG_06460 [Lupinus angustifolius] Length = 326 Score = 68.2 bits (165), Expect = 8e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+S+VSVKG F A LV+Y+HKRTGKQAVIVKQ Sbjct: 186 VESAEPDLKSSKVSVKGVFEAAKLVEYVHKRTGKQAVIVKQ 226 >gb|OMO84155.1| hypothetical protein CCACVL1_10970 [Corchorus capsularis] Length = 326 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F AP LV+Y++KRTGK AVIVKQ Sbjct: 176 VESAEPDLKSSEVTVKGVFEAPKLVEYVYKRTGKHAVIVKQ 216 >gb|OMP08365.1| hypothetical protein COLO4_06546 [Corchorus olitorius] Length = 345 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F AP LV+Y++KRTGK AVIVKQ Sbjct: 193 VESAEPDLKSSEVTVKGVFEAPKLVEYVYKRTGKHAVIVKQ 233 >gb|OTG16623.1| putative heavy metal-associated domain, HMA [Helianthus annuus] Length = 295 Score = 66.2 bits (160), Expect = 3e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 V++ EPDLKAS+V+VKGTF AP LVDYI KRTGK+A++VKQ Sbjct: 171 VDTVEPDLKASQVTVKGTFEAPQLVDYIQKRTGKKAIVVKQ 211 >gb|KJB07099.1| hypothetical protein B456_001G057100 [Gossypium raimondii] gb|KJB07100.1| hypothetical protein B456_001G057100 [Gossypium raimondii] Length = 319 Score = 65.9 bits (159), Expect = 5e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F+ P L++Y++KRTGK AVIVKQ Sbjct: 158 VESAEPDLKSSEVTVKGVFSPPKLIEYVYKRTGKHAVIVKQ 198 >gb|PPR87831.1| hypothetical protein GOBAR_AA32860 [Gossypium barbadense] Length = 320 Score = 65.9 bits (159), Expect = 5e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F+ P L++Y++KRTGK AVIVKQ Sbjct: 158 VESAEPDLKSSEVTVKGVFSPPKLIEYVYKRTGKHAVIVKQ 198 >ref|XP_012467708.1| PREDICTED: neurofilament medium polypeptide [Gossypium raimondii] gb|KJB07098.1| hypothetical protein B456_001G057100 [Gossypium raimondii] Length = 332 Score = 65.9 bits (159), Expect = 6e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F+ P L++Y++KRTGK AVIVKQ Sbjct: 171 VESAEPDLKSSEVTVKGVFSPPKLIEYVYKRTGKHAVIVKQ 211 >ref|XP_016744404.1| PREDICTED: heavy metal-associated isoprenylated plant protein 3-like [Gossypium hirsutum] Length = 333 Score = 65.9 bits (159), Expect = 6e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F+ P L++Y++KRTGK AVIVKQ Sbjct: 172 VESAEPDLKSSEVTVKGVFSPPKLIEYVYKRTGKHAVIVKQ 212 >ref|XP_021633849.1| heavy metal-associated isoprenylated plant protein 7-like isoform X2 [Manihot esculenta] Length = 339 Score = 65.9 bits (159), Expect = 6e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+S+V+VKG F P LVDY++KRTGK AVIVKQ Sbjct: 194 VESAEPDLKSSQVTVKGVFDPPKLVDYVYKRTGKHAVIVKQ 234 >ref|XP_021633848.1| heavy metal-associated isoprenylated plant protein 7-like isoform X1 [Manihot esculenta] gb|OAY30663.1| hypothetical protein MANES_14G049200 [Manihot esculenta] Length = 340 Score = 65.9 bits (159), Expect = 6e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+S+V+VKG F P LVDY++KRTGK AVIVKQ Sbjct: 195 VESAEPDLKSSQVTVKGVFDPPKLVDYVYKRTGKHAVIVKQ 235 >gb|ONI07940.1| hypothetical protein PRUPE_5G148500 [Prunus persica] Length = 320 Score = 65.5 bits (158), Expect = 7e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F P LV+Y+HKRTGK A IVKQ Sbjct: 174 VESAEPDLKSSEVTVKGVFDPPQLVEYVHKRTGKHASIVKQ 214 >ref|XP_023894485.1| heavy metal-associated isoprenylated plant protein 7-like [Quercus suber] gb|POE58356.1| isoform 2 of heavy metal-associated isoprenylated plant protein 7 [Quercus suber] Length = 323 Score = 65.5 bits (158), Expect = 7e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F P LV+Y++KRTGK AVIVKQ Sbjct: 182 VESAEPDLKSSEVTVKGVFDPPKLVEYVYKRTGKHAVIVKQ 222 >ref|XP_021818294.1| heavy metal-associated isoprenylated plant protein 7-like [Prunus avium] Length = 326 Score = 65.5 bits (158), Expect = 7e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F P LV+Y+HKRTGK A IVKQ Sbjct: 187 VESAEPDLKSSEVTVKGVFDPPQLVEYVHKRTGKHASIVKQ 227 >ref|XP_020420193.1| heavy metal-associated isoprenylated plant protein 7-like [Prunus persica] gb|ONI07939.1| hypothetical protein PRUPE_5G148500 [Prunus persica] Length = 327 Score = 65.5 bits (158), Expect = 7e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F P LV+Y+HKRTGK A IVKQ Sbjct: 181 VESAEPDLKSSEVTVKGVFDPPQLVEYVHKRTGKHASIVKQ 221 >ref|XP_017974007.1| PREDICTED: heavy metal-associated isoprenylated plant protein 3 isoform X2 [Theobroma cacao] Length = 327 Score = 65.5 bits (158), Expect = 7e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F P LV+Y++KRTGK AVIVKQ Sbjct: 184 VESAEPDLKSSEVTVKGVFDPPKLVEYVYKRTGKHAVIVKQ 224 >ref|XP_008239502.1| PREDICTED: heavy metal-associated isoprenylated plant protein 3 [Prunus mume] Length = 330 Score = 65.5 bits (158), Expect = 8e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F P LV+Y+HKRTGK A IVKQ Sbjct: 186 VESAEPDLKSSEVTVKGVFDPPQLVEYVHKRTGKHASIVKQ 226 >ref|XP_017974006.1| PREDICTED: heavy metal-associated isoprenylated plant protein 3 isoform X1 [Theobroma cacao] Length = 335 Score = 65.5 bits (158), Expect = 8e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 398 VESAEPDLKASEVSVKGTFTAPALVDYIHKRTGKQAVIVKQ 276 VESAEPDLK+SEV+VKG F P LV+Y++KRTGK AVIVKQ Sbjct: 192 VESAEPDLKSSEVTVKGVFDPPKLVEYVYKRTGKHAVIVKQ 232