BLASTX nr result
ID: Chrysanthemum21_contig00040272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00040272 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021993614.1| alanine--tRNA ligase [Helianthus annuus] >gi... 55 7e-06 >ref|XP_021993614.1| alanine--tRNA ligase [Helianthus annuus] gb|OTG08088.1| putative alanyl-tRNA synthetase [Helianthus annuus] Length = 1001 Score = 54.7 bits (130), Expect = 7e-06 Identities = 27/47 (57%), Positives = 31/47 (65%) Frame = +1 Query: 40 KKPDFPFVMDAIVTSKLRKRMVATTNDSLKFKWFEEHNNRNKVIYTG 180 K+ VMDA TS L KR VATTNDS KF WF++H + K IYTG Sbjct: 508 KQAAVTIVMDADATSALHKRGVATTNDSFKFTWFKDHKSVIKAIYTG 554