BLASTX nr result
ID: Chrysanthemum21_contig00040263
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00040263 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI06002.1| protein of unknown function DUF292, eukaryotic [C... 87 3e-17 ref|XP_023738775.1| IST1-like protein [Lactuca sativa] 60 7e-08 gb|PLY96943.1| hypothetical protein LSAT_4X102360 [Lactuca sativa] 60 7e-08 >gb|KVI06002.1| protein of unknown function DUF292, eukaryotic [Cynara cardunculus var. scolymus] Length = 576 Score = 86.7 bits (213), Expect = 3e-17 Identities = 45/81 (55%), Positives = 55/81 (67%), Gaps = 1/81 (1%) Frame = +1 Query: 1 KSLETKLYTPP-VVQDWSRYDNGAKNESVKPHHQYVYEAKIQETEMTHNNKQTEVTKKEH 177 K+LE LY PP VQDWS+Y N +E++K HHQ +E +IQE E H+NKQTEV KK H Sbjct: 174 KALEQSLYKPPPFVQDWSQYANERNHEALKTHHQNGFETRIQEKEEKHSNKQTEVAKKGH 233 Query: 178 TPIKELPYKPKAETEKKVEKQ 240 LPYK +AE EKK EK+ Sbjct: 234 ---NALPYKSRAEIEKKEEKK 251 >ref|XP_023738775.1| IST1-like protein [Lactuca sativa] Length = 503 Score = 59.7 bits (143), Expect = 7e-08 Identities = 42/103 (40%), Positives = 48/103 (46%), Gaps = 3/103 (2%) Frame = +1 Query: 1 KSLETKLYTPP-VVQDWSRYDNGAKNESVKPHHQYVYEAKIQETEMTHNNKQTEVTKKEH 177 K+ E KLY PP VQD N + K HHQ E T KQ++V KKEH Sbjct: 174 KASEHKLYKPPQFVQDSCENVNERNKQLPKLHHQNGVE--------TTEKKQSKVAKKEH 225 Query: 178 TPIKELPYKPK--AETEKKVEKQKDLNVGNGLPYTPRAEVKTK 300 T E PYK K AE E + + GN LPY R EV K Sbjct: 226 TVENEFPYKYKSWAEAEVETKNNNKQRTGNSLPYKSRGEVVKK 268 >gb|PLY96943.1| hypothetical protein LSAT_4X102360 [Lactuca sativa] Length = 561 Score = 59.7 bits (143), Expect = 7e-08 Identities = 42/103 (40%), Positives = 48/103 (46%), Gaps = 3/103 (2%) Frame = +1 Query: 1 KSLETKLYTPP-VVQDWSRYDNGAKNESVKPHHQYVYEAKIQETEMTHNNKQTEVTKKEH 177 K+ E KLY PP VQD N + K HHQ E T KQ++V KKEH Sbjct: 232 KASEHKLYKPPQFVQDSCENVNERNKQLPKLHHQNGVE--------TTEKKQSKVAKKEH 283 Query: 178 TPIKELPYKPK--AETEKKVEKQKDLNVGNGLPYTPRAEVKTK 300 T E PYK K AE E + + GN LPY R EV K Sbjct: 284 TVENEFPYKYKSWAEAEVETKNNNKQRTGNSLPYKSRGEVVKK 326