BLASTX nr result
ID: Chrysanthemum21_contig00040156
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00040156 (517 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI02092.1| hypothetical protein Ccrd_019628 [Cynara carduncu... 78 1e-13 ref|XP_023741661.1| pentatricopeptide repeat-containing protein ... 77 3e-13 >gb|KVI02092.1| hypothetical protein Ccrd_019628 [Cynara cardunculus var. scolymus] Length = 782 Score = 78.2 bits (191), Expect = 1e-13 Identities = 37/58 (63%), Positives = 45/58 (77%) Frame = -3 Query: 515 SPSCFLYNAVVDCCHKTGDSEKAKDLCRKMTEKGFVLSSSFDPLSIKDQELERSQVGI 342 SP+ FLY A+VDCCHK GDSEKA +L R+M EKGF L+S D L+ +QE ERSQVG+ Sbjct: 725 SPNRFLYTALVDCCHKIGDSEKANELSRQMIEKGFALTSFSDALTTNEQEPERSQVGM 782 >ref|XP_023741661.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Lactuca sativa] gb|PLY67754.1| hypothetical protein LSAT_9X103540 [Lactuca sativa] Length = 785 Score = 77.0 bits (188), Expect = 3e-13 Identities = 36/54 (66%), Positives = 45/54 (83%) Frame = -3 Query: 503 FLYNAVVDCCHKTGDSEKAKDLCRKMTEKGFVLSSSFDPLSIKDQELERSQVGI 342 FLYN +V+CC+ GD EKAK+L R+MT+KGFVLSS FD L+ KDQE ERSQ+G+ Sbjct: 732 FLYNLLVECCYNIGDLEKAKELSREMTKKGFVLSSRFDLLTSKDQEPERSQMGM 785