BLASTX nr result
ID: Chrysanthemum21_contig00039908
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00039908 (544 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023754935.1| IAA-amino acid hydrolase ILR1-like 5 [Lactuc... 59 9e-07 gb|PLY92138.1| hypothetical protein LSAT_8X3921 [Lactuca sativa] 57 3e-06 >ref|XP_023754935.1| IAA-amino acid hydrolase ILR1-like 5 [Lactuca sativa] gb|PLY92177.1| hypothetical protein LSAT_8X3941 [Lactuca sativa] Length = 432 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 102 DVEYGSALLSAAKQDKDWLISIRRNIHEYPELGF 1 D +YG+ LLSAAK+DKDWLISIRR +HEYPEL F Sbjct: 30 DEDYGTQLLSAAKEDKDWLISIRRKLHEYPELLF 63 >gb|PLY92138.1| hypothetical protein LSAT_8X3921 [Lactuca sativa] Length = 626 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 96 EYGSALLSAAKQDKDWLISIRRNIHEYPELGF 1 +YG+ LLSAAK+DKDWLISIRR +HEYPEL F Sbjct: 32 DYGTQLLSAAKEDKDWLISIRRKLHEYPELLF 63