BLASTX nr result
ID: Chrysanthemum21_contig00039803
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00039803 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY94880.1| hypothetical protein LSAT_2X101141 [Lactuca sativa] 94 3e-22 >gb|PLY94880.1| hypothetical protein LSAT_2X101141 [Lactuca sativa] Length = 86 Score = 94.4 bits (233), Expect = 3e-22 Identities = 51/84 (60%), Positives = 56/84 (66%), Gaps = 2/84 (2%) Frame = +2 Query: 2 CKPVPXXXXXXXXXXXXXXXGYEKHTFPRARFPLRRMM--ARSHLTSLSTDPSMHKGAAM 175 CKP+ GYE+HTFP RF RR++ A S LTSLSTDPS KGAAM Sbjct: 3 CKPLFFLFFLIFFHLLVMSFGYERHTFPTERFQPRRLLKTAASSLTSLSTDPSKLKGAAM 62 Query: 176 NELQTSVQDSLRKRPPSKSNPSHN 247 NE QTSV+DSLRKRPPS SNPSHN Sbjct: 63 NEPQTSVEDSLRKRPPSASNPSHN 86