BLASTX nr result
ID: Chrysanthemum21_contig00039802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00039802 (703 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY94880.1| hypothetical protein LSAT_2X101141 [Lactuca sativa] 75 3e-14 >gb|PLY94880.1| hypothetical protein LSAT_2X101141 [Lactuca sativa] Length = 86 Score = 75.5 bits (184), Expect = 3e-14 Identities = 44/86 (51%), Positives = 48/86 (55%), Gaps = 2/86 (2%) Frame = +2 Query: 77 MICKPVPXXXXXXXXXXXXXXXGFEKHTXXXXXXXXXXXXXX--SHLTSLSTDPSMHKGA 250 M CKP+ G+E+HT S LTSLSTDPS KGA Sbjct: 1 MTCKPLFFLFFLIFFHLLVMSFGYERHTFPTERFQPRRLLKTAASSLTSLSTDPSKLKGA 60 Query: 251 AMNELQTSVQDSLRKRPPSKSNPSHN 328 AMNE QTSV+DSLRKRPPS SNPSHN Sbjct: 61 AMNEPQTSVEDSLRKRPPSASNPSHN 86