BLASTX nr result
ID: Chrysanthemum21_contig00039763
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00039763 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH89762.1| Armadillo-type fold [Cynara cardunculus var. scol... 42 7e-07 >gb|KVH89762.1| Armadillo-type fold [Cynara cardunculus var. scolymus] Length = 454 Score = 41.6 bits (96), Expect(2) = 7e-07 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +1 Query: 427 LQMLSHIPRHQLCAIIVFLPLLLKPFFSE 513 LQMLSH P H+ CAI VFLP LLK SE Sbjct: 232 LQMLSHSPEHRSCAITVFLPHLLKALVSE 260 Score = 39.3 bits (90), Expect(2) = 7e-07 Identities = 19/36 (52%), Positives = 22/36 (61%) Frame = +2 Query: 320 VKPNAVSVQFLGSIPPNGCGMHLIIGNLLWDSYNVT 427 VK VS GSI NGC +++ GNLLWD NVT Sbjct: 196 VKGKPVSESTSGSILANGCSVNIFTGNLLWDICNVT 231