BLASTX nr result
ID: Chrysanthemum21_contig00039582
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00039582 (664 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023745511.1| putative disease resistance RPP13-like prote... 62 2e-07 gb|PLY64946.1| hypothetical protein LSAT_6X42921 [Lactuca sativa] 62 2e-07 gb|KVI07658.1| Disease resistance protein [Cynara cardunculus va... 57 8e-06 >ref|XP_023745511.1| putative disease resistance RPP13-like protein 2 [Lactuca sativa] Length = 976 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 227 LKAPSSWSHVFSSKQNCINVLFLFYKE*SDHLKVCLLYSVLFTK 358 +K PSSWS VF +QN +N+L L + + SDHLKVCLLYSVLF K Sbjct: 417 MKDPSSWSQVFCCEQNSVNILSLCFNDLSDHLKVCLLYSVLFPK 460 >gb|PLY64946.1| hypothetical protein LSAT_6X42921 [Lactuca sativa] Length = 991 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 227 LKAPSSWSHVFSSKQNCINVLFLFYKE*SDHLKVCLLYSVLFTK 358 +K PSSWS VF +QN +N+L L + + SDHLKVCLLYSVLF K Sbjct: 417 MKDPSSWSQVFCCEQNSVNILSLCFNDLSDHLKVCLLYSVLFPK 460 >gb|KVI07658.1| Disease resistance protein [Cynara cardunculus var. scolymus] Length = 885 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 227 LKAPSSWSHVFSSKQNCINVLFLFYKE*SDHLKVCLLYSVLFTKD 361 +K P+SW VFS +N N+L L Y + +DHLKVCLLYSVLF K+ Sbjct: 340 MKDPNSWCQVFSCMKNSNNILSLCYNDLTDHLKVCLLYSVLFPKE 384