BLASTX nr result
ID: Chrysanthemum21_contig00039452
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00039452 (651 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009337729.1| hypothetical protein 1 [Hubei polero-like vi... 56 9e-06 >ref|YP_009337729.1| hypothetical protein 1 [Hubei polero-like virus 2] gb|APG75785.1| hypothetical protein 1 [Hubei polero-like virus 2] Length = 249 Score = 55.8 bits (133), Expect = 9e-06 Identities = 34/87 (39%), Positives = 44/87 (50%), Gaps = 2/87 (2%) Frame = -1 Query: 429 SIMHLLPLMLCHNV--TASGFLISAPKSMLLAYIRWSIALGFFPELHVLNDSFYINPTKN 256 SI +LPL L T SG L P+S AY+ W + +GFFPE + D IN + Sbjct: 52 SIAFVLPLFLNRKCRFTRSG-LYKVPRSQARAYLEWGLYIGFFPEFVLSPDGMLINLREP 110 Query: 255 GNEASYRMHLRRIITDRISTNIIKHPD 175 E +YR LR +I D I I HP+ Sbjct: 111 TTEGAYRRELRSLIDDVICEGIRGHPE 137