BLASTX nr result
ID: Chrysanthemum21_contig00039407
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00039407 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023459653.1| hypothetical protein CB0940_01784 [Cercospor... 56 3e-08 gb|EME50103.1| hypothetical protein DOTSEDRAFT_41257 [Dothistrom... 53 2e-06 >ref|XP_023459653.1| hypothetical protein CB0940_01784 [Cercospora beticola] gb|PIB01993.1| hypothetical protein CB0940_01784 [Cercospora beticola] Length = 40 Score = 56.2 bits (134), Expect = 3e-08 Identities = 18/22 (81%), Positives = 22/22 (100%) Frame = -3 Query: 253 PVKLPCWCGDDCQCCILPCTIM 188 PVK+PCWCGDDCQCCI+PC++M Sbjct: 19 PVKVPCWCGDDCQCCIIPCSVM 40 >gb|EME50103.1| hypothetical protein DOTSEDRAFT_41257 [Dothistroma septosporum NZE10] Length = 112 Score = 53.1 bits (126), Expect = 2e-06 Identities = 29/62 (46%), Positives = 40/62 (64%), Gaps = 8/62 (12%) Frame = +3 Query: 165 SGVCWT--LHMIVQGRMQHWQSSPHQHGS-----FTGPVGLLIVALDEPDAA-DAVDGGM 320 S W+ ++ IVQGRMQHWQSSPHQ G+ FT P+ L I+A+D A + V+GG+ Sbjct: 41 SAALWSGGIYWIVQGRMQHWQSSPHQQGNLTGGFFTAPLLLAILAVDPAFVAEEVVEGGI 100 Query: 321 LI 326 + Sbjct: 101 AV 102