BLASTX nr result
ID: Chrysanthemum21_contig00038844
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00038844 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023745504.1| pentatricopeptide repeat-containing protein ... 75 8e-13 ref|XP_022012660.1| pentatricopeptide repeat-containing protein ... 65 2e-09 ref|XP_010260794.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-08 ref|XP_011022308.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 ref|XP_009601696.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 ref|XP_004494495.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 ref|XP_021822140.1| pentatricopeptide repeat-containing protein ... 60 1e-07 ref|XP_010649389.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-07 ref|XP_019168757.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-07 ref|XP_006365973.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 ref|XP_007214226.1| pentatricopeptide repeat-containing protein ... 59 3e-07 ref|XP_008226014.1| PREDICTED: pentatricopeptide repeat-containi... 58 5e-07 ref|XP_009775268.1| PREDICTED: pentatricopeptide repeat-containi... 58 6e-07 ref|XP_019418304.1| PREDICTED: pentatricopeptide repeat-containi... 57 9e-07 ref|XP_002304609.1| hypothetical protein POPTR_0003s15430g [Popu... 57 9e-07 ref|XP_015079510.1| PREDICTED: pentatricopeptide repeat-containi... 57 9e-07 gb|PHU14776.1| hypothetical protein BC332_15981 [Capsicum chinense] 57 2e-06 ref|XP_016575004.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|OVA01558.1| Pentatricopeptide repeat [Macleaya cordata] 56 3e-06 gb|PHT45639.1| hypothetical protein CQW23_14797 [Capsicum baccatum] 56 3e-06 >ref|XP_023745504.1| pentatricopeptide repeat-containing protein At5g66520-like [Lactuca sativa] gb|PLY64963.1| hypothetical protein LSAT_8X107420 [Lactuca sativa] Length = 448 Score = 74.7 bits (182), Expect = 8e-13 Identities = 35/57 (61%), Positives = 45/57 (78%), Gaps = 4/57 (7%) Frame = -3 Query: 161 AVAKQVSSIK----PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 A AK +S+IK PTKS+QIY QM+R+SI +DS+ +LYTL +CTH +N PLLRHLH Sbjct: 32 ASAKWISAIKNTSSPTKSMQIYTQMQRQSIPVDSFAVLYTLTSCTHLQNLPLLRHLH 88 >ref|XP_022012660.1| pentatricopeptide repeat-containing protein At5g66520-like [Helianthus annuus] gb|OTF95838.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 446 Score = 65.1 bits (157), Expect = 2e-09 Identities = 33/50 (66%), Positives = 36/50 (72%) Frame = -3 Query: 152 KQVSSIKPTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 KQ SS P KSLQIY M +SI IDS+T+LYTL A TH N PLLRHLH Sbjct: 39 KQSSS--PLKSLQIYTHMHHQSIPIDSFTVLYTLTASTHLHNLPLLRHLH 86 >ref|XP_010260794.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nelumbo nucifera] Length = 437 Score = 60.5 bits (145), Expect = 7e-08 Identities = 24/47 (51%), Positives = 35/47 (74%) Frame = -3 Query: 143 SSIKPTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 ++ P K+L +Y QM+R+ + DS+TIL+TLK+CTH N L+RHLH Sbjct: 30 NAASPYKALHLYTQMQRQGVPFDSFTILFTLKSCTHLENLTLVRHLH 76 >ref|XP_011022308.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Populus euphratica] Length = 431 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P K+LQ+Y M R+SI D+++IL+TLK+CTHF+N ++ HLH Sbjct: 34 PLKALQLYTHMHRQSIPFDTFSILFTLKSCTHFKNLTIIHHLH 76 >ref|XP_009601696.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Nicotiana tomentosiformis] Length = 432 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/43 (55%), Positives = 35/43 (81%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P ++L +YAQM+R++I +DS+ IL+TLK+CT RN PL+ HLH Sbjct: 30 PQRALSLYAQMQRQAIPVDSFAILFTLKSCTELRNLPLICHLH 72 >ref|XP_004494495.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Cicer arietinum] Length = 432 Score = 60.1 bits (144), Expect = 1e-07 Identities = 22/53 (41%), Positives = 38/53 (71%) Frame = -3 Query: 161 AVAKQVSSIKPTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 A+ K SS PTK + +Y+++ R+ + +D++ I++TLK+CTH N P++ HLH Sbjct: 20 AIKKASSSSSPTKPMHLYSKLHRKGVPLDTFCIIFTLKSCTHLYNLPIIHHLH 72 >ref|XP_021822140.1| pentatricopeptide repeat-containing protein At5g66520-like [Prunus avium] Length = 440 Score = 60.1 bits (144), Expect = 1e-07 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P K+L IY+QM RESI DS+++LYTLK+CT RN +++HLH Sbjct: 40 PQKALHIYSQMHRESIPFDSFSMLYTLKSCTQLRNQEIIQHLH 82 >ref|XP_010649389.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 444 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/47 (53%), Positives = 34/47 (72%) Frame = -3 Query: 143 SSIKPTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 SS P K LQ+Y+Q+ R+S DS++IL+T+K+C H RN PL HLH Sbjct: 38 SSSSPYKVLQVYSQLHRQSRPFDSFSILFTIKSCAHLRNLPLFGHLH 84 >ref|XP_019168757.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Ipomoea nil] Length = 419 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = -3 Query: 143 SSIKPTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 SS P ++L++Y QM+R +A DS+ IL+TLK+CT +N P++RHLH Sbjct: 17 SSKTPQRALRLYTQMQRMGVAFDSFAILFTLKSCTPLQNLPIIRHLH 63 >ref|XP_006365973.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 441 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P ++L +YAQM+R++I DS+ IL+TLK+CTH N PL+ HLH Sbjct: 39 PQRALTLYAQMQRQAIPFDSFAILFTLKSCTHLGNLPLICHLH 81 >ref|XP_007214226.1| pentatricopeptide repeat-containing protein At5g66520 [Prunus persica] gb|ONI11668.1| hypothetical protein PRUPE_4G119500 [Prunus persica] Length = 438 Score = 58.5 bits (140), Expect = 3e-07 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P K+L IY+QM R+S+ DS+++LYTLK+CT RN +++HLH Sbjct: 38 PQKALNIYSQMHRQSVPFDSFSMLYTLKSCTQLRNQEIIQHLH 80 >ref|XP_008226014.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Prunus mume] Length = 440 Score = 58.2 bits (139), Expect = 5e-07 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P K+L IY+QM R+S+ DS+++LYTLK+CT RN +++HLH Sbjct: 40 PQKALHIYSQMHRQSVPFDSFSMLYTLKSCTQLRNHEIIQHLH 82 >ref|XP_009775268.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana sylvestris] ref|XP_016509349.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana tabacum] Length = 432 Score = 57.8 bits (138), Expect = 6e-07 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P ++L +YAQM+R++I DS+ IL+TL++CT RN PL+ HLH Sbjct: 30 PRRALSLYAQMQRQAIPFDSFAILFTLRSCTQLRNLPLICHLH 72 >ref|XP_019418304.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like [Lupinus angustifolius] Length = 424 Score = 57.4 bits (137), Expect = 9e-07 Identities = 20/43 (46%), Positives = 35/43 (81%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P KS+ ++++M ++++ DS+ IL+TLK+CTHF N P+++HLH Sbjct: 26 PRKSMHLFSKMHQKNVPFDSFCILFTLKSCTHFHNLPIIQHLH 68 >ref|XP_002304609.1| hypothetical protein POPTR_0003s15430g [Populus trichocarpa] gb|PNT45812.1| hypothetical protein POPTR_003G155600v3 [Populus trichocarpa] Length = 431 Score = 57.4 bits (137), Expect = 9e-07 Identities = 22/43 (51%), Positives = 33/43 (76%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P K+LQ+Y M R+SI D+++IL+TLK+CTH +N ++ HLH Sbjct: 34 PHKALQLYTHMHRQSIPFDTFSILFTLKSCTHLKNLTIIHHLH 76 >ref|XP_015079510.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum pennellii] Length = 441 Score = 57.4 bits (137), Expect = 9e-07 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = -3 Query: 143 SSIKPTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 S+ P ++L +YAQM+R++I DS+ IL+TLK+CT+ N PL+ HLH Sbjct: 35 SAKSPQRALTLYAQMQRQAIPFDSFAILFTLKSCTYLGNLPLICHLH 81 >gb|PHU14776.1| hypothetical protein BC332_15981 [Capsicum chinense] Length = 448 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/43 (51%), Positives = 33/43 (76%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P ++L +Y QM+R++I DS+ IL+TLK+CTH N P++ HLH Sbjct: 46 PQRALTLYTQMQRQAIPFDSFAILFTLKSCTHLGNLPIICHLH 88 >ref|XP_016575004.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Capsicum annuum] gb|PHT79013.1| hypothetical protein T459_17065 [Capsicum annuum] Length = 448 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/43 (51%), Positives = 33/43 (76%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P ++L +Y QM+R++I DS+ IL+TLK+CTH N P++ HLH Sbjct: 46 PQRALTLYTQMQRQAIPFDSFAILFTLKSCTHLGNLPIICHLH 88 >gb|OVA01558.1| Pentatricopeptide repeat [Macleaya cordata] Length = 445 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/52 (51%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = -3 Query: 152 KQVSSIKPTKSLQIYAQMRRESIAIDSYTILYTLKACTHF--RNAPLLRHLH 3 K+ SS P ++L +Y QM+ +SI DSY+IL+T+K+CTHF N L+RHLH Sbjct: 34 KKASS--PQEALNLYKQMQNQSIPFDSYSILFTIKSCTHFLPNNLSLIRHLH 83 >gb|PHT45639.1| hypothetical protein CQW23_14797 [Capsicum baccatum] Length = 448 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/43 (51%), Positives = 32/43 (74%) Frame = -3 Query: 131 PTKSLQIYAQMRRESIAIDSYTILYTLKACTHFRNAPLLRHLH 3 P ++L +Y QM+R++I DS+ IL+TLK CTH N P++ HLH Sbjct: 46 PLRALTLYTQMQRQAIPFDSFAILFTLKLCTHLGNLPIICHLH 88